You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase R
Synonyms
  • 3.1.3.48
  • Ch-1PTPase
  • ECPTP
  • NC-PTPCOM1
  • Protein-tyrosine phosphatase PCPTP1
  • PTPRQ
  • R-PTP-R
Gene NamePTPRR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009014|Receptor-type tyrosine-protein phosphatase R
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQK
IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
Number of residues657
Molecular Weight73833.73
Theoretical pINot Available
GO Classification
Functions
  • protein kinase binding
  • transmembrane receptor protein tyrosine phosphatase activity
  • protein tyrosine phosphatase activity
Processes
  • protein dephosphorylation
  • negative regulation of ERK1 and ERK2 cascade
  • peptidyl-tyrosine dephosphorylation
  • neuron differentiation
  • negative regulation of epithelial cell migration
  • ERBB2 signaling pathway
  • in utero embryonic development
Components
  • perinuclear region of cytoplasm
  • cytoplasm
  • plasma membrane
  • extracellular space
  • cell junction
  • integral component of membrane
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionSequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus (By similarity).
Pfam Domain Function
Transmembrane Regions228-248
GenBank Protein IDNot Available
UniProtKB IDQ15256
UniProtKB Entry NamePTPRR_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0019711|Receptor-type tyrosine-protein phosphatase R (PTPRR)
ATGCAGTCAATTTCCAAACAGACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTG
CTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCAC
ATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGA
AAAACAGGAATTTCTGATGCTCTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAAT
GTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAGAAAAATGTT
TTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTC
ATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAA
GAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCG
CCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCT
GAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAG
ATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGA
CTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAAC
ATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAG
TCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTA
CTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATT
CCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTG
TGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATT
AGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACC
GTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACA
AAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATAT
GGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAAC
CTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGG
CCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAA
GAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATA
GGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGA
GTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAA
ACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCA
GCAGAGACTGTCCAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9680
Chromosome Location12
LocusNot Available
References
  1. Shiozuka K, Watanabe Y, Ikeda T, Hashimoto S, Kawashima H: Cloning and expression of PCPTP1 encoding protein tyrosine phosphatase. Gene. 1995 Sep 11;162(2):279-84. 7557444
  2. Augustine KA, Silbiger SM, Bucay N, Ulias L, Boynton A, Trebasky LD, Medlock ES: Protein tyrosine phosphatase (PC12, Br7,S1) family: expression characterization in the adult human and mouse. Anat Rec. 2000 Mar 1;258(3):221-34. 10705342
  3. Bektas A, Hughes JN, Warram JH, Krolewski AS, Doria A: Type 2 diabetes locus on 12q15. Further mapping and mutation screening of two candidate genes. Diabetes. 2001 Jan;50(1):204-8. 11147789
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075
  6. Eswaran J, von Kries JP, Marsden B, Longman E, Debreczeni JE, Ugochukwu E, Turnbull A, Lee WH, Knapp S, Barr AJ: Crystal structures and inhibitor identification for PTPN5, PTPRR and PTPN7: a family of human MAPK-specific protein tyrosine phosphatases. Biochem J. 2006 May 1;395(3):483-91. 16441242