You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 14
Synonyms
  • 3.1.3.48
  • PEZ
  • Protein-tyrosine phosphatase pez
  • PTPD2
Gene NamePTPN14
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017664|Tyrosine-protein phosphatase non-receptor type 14
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARV
LRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Number of residues1187
Molecular Weight135260.15
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • transcription cofactor activity
  • receptor tyrosine kinase binding
Processes
  • regulation of transcription, DNA-templated
  • negative regulation of cell proliferation
  • transcription, DNA-templated
  • protein dephosphorylation
  • lymphangiogenesis
  • peptidyl-tyrosine dephosphorylation
  • regulation of protein export from nucleus
Components
  • cytoskeleton
  • nucleus
  • nucleoplasm
  • cytoplasm
General FunctionTranscription cofactor activity
Specific FunctionProtein tyrosine phosphatase which may play a role in the regulation of lymphangiogenesis, cell-cell adhesion, cell-matrix adhesion, cell migration, cell growth and also regulates TGF-beta gene expression, thereby modulating epithelial-mesenchymal transition. Mediates beta-catenin dephosphorylation at adhesion junctions. Acts as a negative regulator of the oncogenic property of YAP, a downstream target of the hippo pathway, in a cell density-dependent manner. May function as a tumor suppressor.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ15678
UniProtKB Entry NamePTN14_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0017665|Tyrosine-protein phosphatase non-receptor type 14 (PTPN14)
ATGCCTTTTGGTCTGAAGCTCCGCCGGACACGGCGCTACAACGTCCTGAGCAAGAACTGC
TTTGTCACACGGATTCGCCTGCTGGACAGCAATGTTATCGAGTGCACGCTGTCGGTGGAA
AGCACAGGGCAAGAATGCCTGGAGGCTGTGGCCCAGAGGCTGGAGCTGCGAGAGACGCAC
TACTTTGGCCTTTGGTTTCTCAGCAAGAGCCAGCAAGCACGATGGGTGGAGCTGGAGAAA
CCTCTGAAGAAACATCTGGACAAATTCGCTAATGAGCCTTTGCTTTTCTTTGGAGTCATG
TTCTATGTGCCAAATGTGTCATGGCTTCAGCAAGAGGCCACAAGATATCAGTATTACCTG
CAAGTCAAAAAAGATGTGCTTGAAGGGCGATTACGATGTACATTGGACCAGGTGATTCGG
CTAGCCGGCCTAGCTGTGCAAGCTGATTTTGGAGACTATAATCAGTTTGATTCTCAAGAT
TTCCTCAGAGAGTATGTGCTATTTCCTATGGATTTGGCCCTGGAAGAGGCTGTTCTGGAG
GAGCTGACCCAGAAGGTAGCCCAAGAACACAAAGCCCACAGTGGAATCCTGCCAGCAGAA
GCTGAACTGATGTACATCAATGAAGTTGAACGTTTGGATGGATTTGGACAGGAAATCTTC
CCTGTAAAGGACAATCATGGAAACTGTGTACACCTTGGCATTTTCTTTATGGGGATTTTC
GTGAGGAACAGAATTGGAAGACAAGCGGTAATATACAGGTGGAATGACATGGGGAATATC
ACTCATAACAAGTCGACCATTCTAGTGGAGCTCATCAACAAAGAAGAGACTGCCCTCTTT
CACACGGATGATATCGAAAATGCCAAGTATATTTCTCGGTTGTTTGCCACACGACACAAG
TTTTACAAACAAAACAAAATCTGCACTGAACAGTCAAATTCTCCACCCCCCATCAGACGC
CAGCCCACCTGGAGCCGATCCTCTCTGCCCAGGCAGCAGCCGTACATCCTGCCTCCCGTT
CACGTCCAGTGTGGTGAGCACTACTCGGAAACGCACACCTCGCAAGACAGCATTTTTCAT
GGGAATGAAGAAGCCTTGTATTGCAACTCTCACAACAGCCTGGACTTAAATTATTTAAAT
GGCACTGTCACCAATGGCAGCGTGTGTAGCGTTCACAGCGTCAACTCCCTCAACTGCTCG
CAAAGTTTCATCCAGGCCTCCCCTGTATCCTCCAACCTCAGTATCCCTGGGAGTGACATC
ATGCGGGCCGACTACATCCCGAGCCACCGGCACAGCGCGATCATCGTGCCCTCGTACAGG
CCAACCCCCGATTATGAGACAGTCATGCGCCAGATGAAGAGGGGGATCCTGCATACAGAC
AGCCAGAGCCAGTCTCTGAGAAACCTCAACATTATCAACACCCATGCCTACAACCAGCCA
GAGGATCTGGTGTACAGCCAACCGGAGATGCGGGAGAGGCACCCCTACACTGTCCCTTAT
GGGCCACAGGGGGTCTACAGCAACAAACTTGTCAGTCCATCTGACCAGAGGAACCCAAAG
AATAATGTGGTACCAAGCAAGCCGGGGGCAAGCGCCATCTCGCACACGGTGAGCACCCCA
GAGCTGGCCAACATGCAGCTGCAGGGCAGCCATAACTACAGCACGGCCCACATGCTTAAG
AACTATCTCTTCAGGCCACCGCCCCCCTACCCACGGCCACGACCTGCCACCAGCACCCCA
GACCTGGCCAGCCACCGCCACAAGTACGTCAGCGGCAGCAGCCCGGACCTGGTGACCCGG
AAGGTGCAGCTCTCGGTGAAGACCTTCCAAGAGGACAGCTCTCCGGTGGTTCATCAGTCT
CTCCAGGAGGTGAGCGAGCCCCTCACGGCCACCAAGCACCACGGCACTGTGAACAAGCGC
CACAGCCTGGAGGTGATGAACAGCATGGTGCGGGGCATGGAGGCCATGACGCTCAAGTCG
CTCCACCTCCCCATGGCTCGCCGCAACACGCTCCGGGAGCAGGGACCGCCCGAGGAGGGG
TCAGGCAGCCACGAGGTCCCCCAGCTCCCTCAGTATCACCACAAGAAGACCTTCTCTGAT
GCCACTATGCTAATCCACAGCAGCGAGAGTGAGGAGGAGGAGGAGGAGGCTCCAGAATCG
GTGCCCCAGATCCCCATGCTCCGGGAGAAGATGGAGTACAGTGCCCAGCTGCAGGCGGCC
CTGGCCCGCATCCCCAACAAGCCCCCGCCTGAGTACCCCGGTCCAAGGAAGAGTGTGAGC
AATGGGGCTCTGAGGCAGGACCAAGCCAGCCTTCCTCCCGCCATGGCCAGAGCCAGGGTG
CTGAGGCATGGGCCAGCCAAGGCCATCAGCATGTCTCGGACTGACCCGCCGGCTGTCAAC
GGGGCCTCTCTCGGCCCATCCATCTCGGAACCCGACCTGACTAGTGTGAAGGAGCGGGTC
AAAAAAGAGCCTGTGAAGGAGAGACCTGTGTCTGAAATGTTTTCCCTGGAAGACAGCATT
ATAGAGAGAGAGATGATGATCAGGAATCTAGAGAAGCAGAAGATGGCAGGCCTGGAGGCA
CAGAAGAGGCCGCTGATGTTGGCAGCATTGAATGGGCTCTCGGTGGCTCGAGTCTCAGGG
CGGGAAGAGAATCGAGTTGATGCCACCCGGGTTCCCATGGACGAGAGGTTCAGAACCCTG
AAGAAGAAACTAGAAGAGGGAATGGTGTTCACAGAATATGAGCAAATTCCAAAGAAAAAG
GCGAATGGCATTTTCAGCACAGCAGCTCTGCCAGAAAACGCCGAGCGCAGCCGAATCCGT
GAAGTTGTCCCCTATGAGGAGAATCGAGTAGAGCTGATACCAACCAAAGAAAATAACACA
GGATACATTAATGCCTCCCACATCAAGGTGGTGGTTGGCGGGGCAGAATGGCACTACATA
GCCACCCAGGGGCCCCTGCCACACACGTGCCACGACTTCTGGCAGATGGTGTGGGAGCAG
GGAGTGAATGTGATTGCCATGGTCACTGCAGAGGAGGAGGGTGGACGAACCAAAAGCCAC
CGATACTGGCCCAAACTAGGTTCAAAGCACAGCTCAGCCACCTATGGCAAGTTCAAGGTC
ACCACGAAGTTTCGAACGGATTCTGTTTGCTATGCAACCACGGGCTTGAAGGTCAAGCAC
CTTTTGTCTGGGCAAGAAAGGACGGTGTGGCATTTACAATATACTGACTGGCCAGATCAC
GGCTGTCCAGAAGATGTCCAAGGATTTTTATCCTACTTGGAGGAGATCCAGTCGGTCCGT
CGCCATACCAACAGCATGCTGGAAGGCACCAAGAACCGGCACCCGCCCATCGTGGTCCAC
TGTAGTGCTGGGGTGGGAAGGACCGGCGTGCTCATTCTTTCTGAGCTGATGATCTACTGC
TTGGAACATAACGAAAAGGTGGAAGTGCCCATGATGCTGAGGCTCCTCAGGGAGCAGAGG
ATGTTCATGATCCAGACTATCGCTCAGTACAAGTTTGTCTACCAAGTCCTCATCCAGTTC
CTCCAAAACTCCAGACTCATTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9647
Chromosome Location1
LocusNot Available
References
  1. Smith AL, Mitchell PJ, Shipley J, Gusterson BA, Rogers MV, Crompton MR: Pez: a novel human cDNA encoding protein tyrosine phosphatase- and ezrin-like domains. Biochem Biophys Res Commun. 1995 Apr 26;209(3):959-65. 7733990
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Wadham C, Gamble JR, Vadas MA, Khew-Goodall Y: Translocation of protein tyrosine phosphatase Pez/PTPD2/PTP36 to the nucleus is associated with induction of cell proliferation. J Cell Sci. 2000 Sep;113 ( Pt 17):3117-23. 10934049
  5. Wadham C, Gamble JR, Vadas MA, Khew-Goodall Y: The protein tyrosine phosphatase Pez is a major phosphatase of adherens junctions and dephosphorylates beta-catenin. Mol Biol Cell. 2003 Jun;14(6):2520-9. Epub 2003 Feb 6. 12808048
  6. Wyatt L, Wadham C, Crocker LA, Lardelli M, Khew-Goodall Y: The protein tyrosine phosphatase Pez regulates TGFbeta, epithelial-mesenchymal transition, and organ development. J Cell Biol. 2007 Sep 24;178(7):1223-35. 17893246
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  9. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  10. Au AC, Hernandez PA, Lieber E, Nadroo AM, Shen YM, Kelley KA, Gelb BD, Diaz GA: Protein tyrosine phosphatase PTPN14 is a regulator of lymphatic function and choanal development in humans. Am J Hum Genet. 2010 Sep 10;87(3):436-44. doi: 10.1016/j.ajhg.2010.08.008. 20826270
  11. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  12. Wang W, Huang J, Wang X, Yuan J, Li X, Feng L, Park JI, Chen J: PTPN14 is required for the density-dependent control of YAP1. Genes Dev. 2012 Sep 1;26(17):1959-71. doi: 10.1101/gad.192955.112. 22948661
  13. Benzinou M, Clermont FF, Letteboer TG, Kim JH, Espejel S, Harradine KA, Arbelaez J, Luu MT, Roy R, Quigley D, Higgins MN, Zaid M, Aouizerat BE, van Amstel JK, Giraud S, Dupuis-Girod S, Lesca G, Plauchu H, Hughes CC, Westermann CJ, Akhurst RJ: Mouse and human strategies identify PTPN14 as a modifier of angiogenesis and hereditary haemorrhagic telangiectasia. Nat Commun. 2012 Jan 10;3:616. doi: 10.1038/ncomms1633. 22233626
  14. Liu X, Yang N, Figel SA, Wilson KE, Morrison CD, Gelman IH, Zhang J: PTPN14 interacts with and negatively regulates the oncogenic function of YAP. Oncogene. 2013 Mar 7;32(10):1266-73. doi: 10.1038/onc.2012.147. Epub 2012 Apr 23. 22525271
  15. Barr AJ, Debreczeni JE, Eswaran J, Knapp S: Crystal structure of human protein tyrosine phosphatase 14 (PTPN14) at 1.65-A resolution. Proteins. 2006 Jun 1;63(4):1132-6. 16534812
  16. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974