You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLeukotriene B4 receptor 1
Synonyms
  • BLT
  • BLT1
  • BLTR
  • Chemoattractant receptor-like 1
  • CMKRL1
  • G-protein coupled receptor 16
  • GPR16
  • LTB4-R 1
  • P2RY7
  • P2Y purinoceptor 7
  • P2Y7
Gene NameLTB4R
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006762|Leukotriene B4 receptor 1
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Number of residues352
Molecular Weight37556.925
Theoretical pI11.63
GO Classification
Functions
  • G-protein coupled peptide receptor activity
  • leukotriene B4 receptor activity
  • nucleotide binding
  • leukotriene receptor activity
Processes
  • neuropeptide signaling pathway
  • G-protein coupled receptor signaling pathway
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • movement of cell or subcellular component
  • muscle contraction
  • leukotriene signaling pathway
  • immune response
  • inflammatory response
Components
  • integral component of plasma membrane
  • membrane raft
  • plasma membrane
General FunctionNucleotide binding
Specific FunctionReceptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Pfam Domain Function
Transmembrane Regions20-42 55-75 92-113 139-159 179-199 222-242 269-289
GenBank Protein IDNot Available
UniProtKB IDQ15722
UniProtKB Entry NameLT4R1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0012433|Leukotriene B4 receptor 1 (LTB4R)
ATGAACACTACATCTTCTGCAGCACCCCCCTCACTAGGTGTAGAGTTCATCTCTCTGCTG
GCTATCATCCTGCTGTCAGTGGCGCTGGCTGTGGGGCTTCCCGGCAACAGCTTTGTGGTG
TGGAGTATCCTGAAAAGGATGCAGAAGCGCTCTGTCACTGCCCTGATGGTGCTGAACCTG
GCCCTGGCCGACCTGGCCGTATTGCTCACTGCTCCCTTTTTCCTTCACTTCCTGGCCCAA
GGCACCTGGAGTTTTGGACTGGCTGGTTGCCGCCTGTGTCACTATGTCTGCGGAGTCAGC
ATGTACGCCAGCGTCCTGCTTATCACGGCCATGAGTCTAGACCGCTCACTGGCGGTGGCC
CGCCCCTTTGTGTCCCAGAAGCTACGCACCAAGGCGATGGCCCGGCGGGTGCTGGCAGGC
ATCTGGGTGTTGTCCTTTCTGCTGGCCACACCCGTCCTCGCGTACCGCACAGTAGTGCCC
TGGAAAACGAACATGAGCCTGTGCTTCCCGCGGTACCCCAGCGAAGGGCACCGGGCCTTC
CATCTAATCTTCGAGGCTGTCACGGGCTTCCTGCTGCCCTTCCTGGCTGTGGTGGCCAGC
TACTCGGACATAGGGCGTCGGCTACAGGCCCGGCGCTTCCGCCGCAGCCGCCGCACCGGC
CGCCTGGTGGTGCTCATCATCCTGACCTTCGCCGCCTTCTGGCTGCCCTACCACGTGGTG
AACCTGGCTGAGGCGGGCCGCGCGCTGGCCGGCCAGGCCGCCGGGTTAGGGCTCGTGGGG
AAGCGGCTGAGCCTGGCCCGCAACGTGCTCATCGCACTCGCCTTCCTGAGCAGCAGCGTG
AACCCCGTGCTGTACGCGTGCGCCGGCGGCGGCCTGCTGCGCTCGGCGGGCGTGGGCTTC
GTCGCCAAGCTGCTGGAGGGCACGGGCTCCGAGGCGTCCAGCACGCGCCGCGGGGGCAGC
CTGGGCCAGACCGCTAGGAGCGGCCCCGCCGCTCTGGAGCCCGGCCCTTCCGAGAGCCTC
ACTGCCTCCAGCCCTCTCAAGTTAAACGAACTGAACTAG
GenBank Gene IDBC004545
GeneCard IDNot Available
GenAtlas IDLTB4R
HGNC IDHGNC:6713
Chromosome Location14
LocusNot Available
References
  1. Akbar GK, Dasari VR, Webb TE, Ayyanathan K, Pillarisetti K, Sandhu AK, Athwal RS, Daniel JL, Ashby B, Barnard EA, Kunapuli SP: Molecular cloning of a novel P2 purinoceptor from human erythroleukemia cells. J Biol Chem. 1996 Aug 2;271(31):18363-7. 8702478
  2. Raport CJ, Schweickart VL, Chantry D, Eddy RL Jr, Shows TB, Godiska R, Gray PW: New members of the chemokine receptor gene family. J Leukoc Biol. 1996 Jan;59(1):18-23. 8558062
  3. Yokomizo T, Izumi T, Chang K, Takuwa Y, Shimizu T: A G-protein-coupled receptor for leukotriene B4 that mediates chemotaxis. Nature. 1997 Jun 5;387(6633):620-4. 9177352
  4. Owman C, Nilsson C, Lolait SJ: Cloning of cDNA encoding a putative chemoattractant receptor. Genomics. 1996 Oct 15;37(2):187-94. 8921391
  5. Kato K, Yokomizo T, Izumi T, Shimizu T: Cell-specific transcriptional regulation of human leukotriene B(4) receptor gene. J Exp Med. 2000 Aug 7;192(3):413-20. 10934229
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Gaudreau R, Le Gouill C, Venne MH, Stankova J, Rola-Pleszczynski M: Threonine 308 within a putative casein kinase 2 site of the cytoplasmic tail of leukotriene B(4) receptor (BLT1) is crucial for ligand-induced, G-protein-coupled receptor-specific kinase 6-mediated desensitization. J Biol Chem. 2002 Aug 30;277(35):31567-76. Epub 2002 Jun 20. 12077128