Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTGF-beta-activated kinase 1 and MAP3K7-binding protein 1
Synonyms
  • MAP3K7IP1
  • Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
  • TAK1-binding protein 1
  • TGF-beta-activated kinase 1-binding protein 1
Gene NameTAB1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009853|TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
Number of residues504
Molecular Weight54643.655
Theoretical pINot Available
GO Classification
Functions
  • enzyme activator activity
  • kinase activator activity
  • protein serine/threonine phosphatase activity
Processes
  • toll-like receptor 9 signaling pathway
  • innate immune response
  • heart morphogenesis
  • toll-like receptor signaling pathway
  • Fc-epsilon receptor signaling pathway
  • positive regulation of NF-kappaB transcription factor activity
  • toll-like receptor TLR1
  • lung development
  • MyD88-dependent toll-like receptor signaling pathway
  • toll-like receptor TLR6
  • stimulatory C-type lectin receptor signaling pathway
  • MyD88-independent toll-like receptor signaling pathway
  • TRIF-dependent toll-like receptor signaling pathway
  • cell surface receptor signaling pathway
  • stress-activated MAPK cascade
  • nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
  • transforming growth factor beta receptor signaling pathway
  • toll-like receptor 10 signaling pathway
  • nucleotide-binding oligomerization domain containing signaling pathway
  • activation of MAPK activity
  • toll-like receptor 2 signaling pathway
  • activation of MAPKKK activity
  • JNK cascade
  • toll-like receptor 3 signaling pathway
  • in utero embryonic development
  • I-kappaB kinase/NF-kappaB signaling
  • toll-like receptor 4 signaling pathway
  • tumor necrosis factor-mediated signaling pathway
  • toll-like receptor 5 signaling pathway
Components
  • nucleoplasm
  • endosome membrane
  • cytoplasm
  • protein complex
  • cytosol
General FunctionProtein serine/threonine phosphatase activity
Specific FunctionMay be an important signaling intermediate between TGFB receptors and MAP3K7/TAK1. May play an important role in mammalian embryogenesis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ15750
UniProtKB Entry NameTAB1_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0019815|TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1)
ATGGCGGCGCAGAGGAGGAGCTTGCTGCAGAGTGAGCAGCAGCCAAGCTGGACAGATGAC
CTGCCTCTCTGCCACCTCTCTGGGGTTGGCTCAGCCTCCAACCGCAGCTACTCTGCTGAT
GGCAAGGGCACTGAGAGCCACCCGCCAGAGGACAGCTGGCTCAAGTTCAGGAGTGAGAAC
AACTGCTTCCTGTATGGGGTCTTCAACGGCTATGATGGCAACCGAGTGACCAACTTCGTG
GCCCAGCGGCTGTCCGCAGAGCTCCTGCTGGGCCAGCTGAATGCCGAGCACGCCGAGGCC
GATGTGCGGCGTGTGCTGCTGCAGGCCTTCGATGTGGTGGAGAGGAGCTTCCTGGAGTCC
ATTGACGACGCCTTGGCTGAGAAGGCAAGCCTCCAGTCGCAATTGCCAGAGGGAGTCCCT
CAGCACCAGCTGCCTCCTCAGTATCAGAAGATCCTTGAGAGACTCAAGACGTTAGAGAGG
GAAATTTCGGGAGGGGCCATGGCCGTTGTGGCGGTCCTTCTCAACAACAAGCTCTACGTC
GCCAATGTCGGTACAAACCGTGCACTTTTATGCAAATCGACAGTGGATGGGTTGCAGGTG
ACACAGCTGAACGTGGACCACACCACAGAGAACGAGGATGAGCTCTTCCGTCTTTCGCAG
CTGGGCTTGGATGCTGGAAAGATCAAGCAGGTGGGGATCATCTGTGGGCAGGAGAGCACC
CGGCGGATCGGGGATTACAAGGTTAAATATGGCTACACGGACATTGACCTTCTCAGCGCT
GCCAAGTCCAAACCAATCATCGCAGAGCCAGAAATCCATGGGGCACAGCCGCTGGATGGG
GTGACGGGCTTCTTGGTGCTGATGTCGGAGGGGTTGTACAAGGCCCTAGAGGCAGCCCAT
GGGCCTGGGCAGGCCAACCAGGAGATTGCTGCGATGATTGACACTGAGTTTGCCAAGCAG
ACCTCCCTGGACGCAGTGGCCCAGGCCGTCGTGGACCGGGTGAAGCGCATCCACAGCGAC
ACCTTCGCCAGTGGTGGGGAGCGTGCCAGGTTCTGCCCCCGGCACGAGGACATGACCCTG
CTAGTGAGGAACTTTGGCTACCCGCTGGGCGAAATGAGCCAGCCCACACCGAGCCCAGCC
CCAGCTGCAGGAGGACGAGTGTACCCTGTGTCTGTGCCATACTCCAGCGCCCAGAGCACC
AGCAAGACCAGCGTGACCCTCTCCCTTGTCATGCCCTCCCAGGGCCAGATGGTCAACGGG
GCTCACAGTGCTTCCACCCTGGACGAAGCCACCCCCACCCTCACCAACCAAAGCCCGACC
TTAACCCTGCAGTCCACCAACACGCACACGCAGAGCAGCAGCTCCAGCTCTGACGGAGGC
CTCTTCCGCTCCCGGCCCGCCCACTCGCTCCCGCCTGGCGAGGACGGTCGTGTTGAGCCC
TATGTGGACTTTGCTGAGTTTTACCGCCTCTGGAGCGTGGACCATGGCGAGCAGAGCGTG
GTGACAGCACCGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:18157
Chromosome Location22
LocusNot Available
References
  1. Shibuya H, Yamaguchi K, Shirakabe K, Tonegawa A, Gotoh Y, Ueno N, Irie K, Nishida E, Matsumoto K: TAB1: an activator of the TAK1 MAPKKK in TGF-beta signal transduction. Science. 1996 May 24;272(5265):1179-82. 8638164
  2. Ge B, Xiong X, Jing Q, Mosley JL, Filose A, Bian D, Huang S, Han J: TAB1beta (transforming growth factor-beta-activated protein kinase 1-binding protein 1beta ), a novel splicing variant of TAB1 that interacts with p38alpha but not TAK1. J Biol Chem. 2003 Jan 24;278(4):2286-93. Epub 2002 Nov 11. 12429732
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Ninomiya-Tsuji J, Kishimoto K, Hiyama A, Inoue J, Cao Z, Matsumoto K: The kinase TAK1 can activate the NIK-I kappaB as well as the MAP kinase cascade in the IL-1 signalling pathway. Nature. 1999 Mar 18;398(6724):252-6. 10094049
  6. Wang C, Deng L, Hong M, Akkaraju GR, Inoue J, Chen ZJ: TAK1 is a ubiquitin-dependent kinase of MKK and IKK. Nature. 2001 Jul 19;412(6844):346-51. 11460167
  7. Thiefes A, Wolf A, Doerrie A, Grassl GA, Matsumoto K, Autenrieth I, Bohn E, Sakurai H, Niedenthal R, Resch K, Kracht M: The Yersinia enterocolitica effector YopP inhibits host cell signalling by inactivating the protein kinase TAK1 in the IL-1 signalling pathway. EMBO Rep. 2006 Aug;7(8):838-44. Epub 2006 Jul 14. 16845370
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  10. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  11. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  14. Conner SH, Kular G, Peggie M, Shepherd S, Schuttelkopf AW, Cohen P, Van Aalten DM: TAK1-binding protein 1 is a pseudophosphatase. Biochem J. 2006 Nov 1;399(3):427-34. 16879102
  15. Lu M, Lin SC, Huang Y, Kang YJ, Rich R, Lo YC, Myszka D, Han J, Wu H: XIAP induces NF-kappaB activation via the BIR1/TAB1 interaction and BIR1 dimerization. Mol Cell. 2007 Jun 8;26(5):689-702. 17560374