You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuropeptide Y receptor type 5
Synonyms
  • NPY-Y5 receptor
  • NPY5-R
  • NPYR5
  • NPYY5-R
  • Y5 receptor
Gene NameNPY5R
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037208|Neuropeptide Y receptor type 5
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Number of residues445
Molecular Weight50725.99
Theoretical pI8.84
GO Classification
Functions
  • pancreatic polypeptide receptor activity
  • peptide YY receptor activity
  • neuropeptide Y receptor activity
Processes
  • positive regulation of smooth muscle cell proliferation
  • negative regulation of glutamate secretion
  • feeding behavior
  • eating behavior
  • positive regulation of acute inflammatory response
  • neuropeptide signaling pathway
  • outflow tract morphogenesis
  • synaptic transmission
  • cardiac left ventricle morphogenesis
  • generation of ovulation cycle rhythm
  • negative regulation of apoptotic process
  • G-protein coupled receptor signaling pathway
  • cell surface receptor signaling pathway
  • negative regulation of synaptic transmission, GABAergic
Components
  • cytoplasm
  • plasma membrane
  • integral component of plasma membrane
  • neuron projection
General FunctionPeptide yy receptor activity
Specific FunctionReceptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders.
Pfam Domain Function
Transmembrane Regions43-63 78-98 118-138 157-177 209-229 370-390 408-428
GenBank Protein IDNot Available
UniProtKB IDQ15761
UniProtKB Entry NameNPY5R_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0011756|Neuropeptide Y receptor type 5 (NPY5R)
ATGGATTTAGAGCTCGACGAGTATTATAACAAGACACTTGCCACAGAGAATAATACTGCT
GCCACTCGGAATTCTGATTTCCCAGTCTGGGATGACTATAAAAGCAGTGTAGATGACTTA
CAGTATTTTCTGATTGGGCTCTATACATTTGTAAGTCTTCTTGGCTTTATGGGGAATCTA
CTTATTTTAATGGCTCTCATGAAAAAGCGTAATCAGAAGACTACGGTAAACTTCCTCATA
GGCAATCTGGCCTTTTCTGATATCTTGGTTGTGCTGTTTTGCTCACCTTTCACACTGACG
TCTGTCTTGCTGGATCAGTGGATGTTTGGCAAAGTCATGTGCCATATTATGCCTTTTCTT
CAATGTGTGTCAGTTTTGGTTTCAACTTTAATTTTAATATCAATTGCCATTGTCAGGTAT
CATATGATAAAACATCCCATATCTAATAATTTAACAGCAAACCATGGCTACTTTCTGATA
GCTACTGTCTGGACACTAGGTTTTGCCATCTGTTCTCCCCTTCCAGTGTTTCACAGTCTT
GTGGAACTTCAAGAAACATTTGGTTCAGCATTGCTGAGCAGCAGGTATTTATGTGTTGAG
TCATGGCCATCTGATTCATACAGAATTGCCTTTACTATCTCTTTATTGCTAGTTCAGTAT
ATTCTGCCCTTAGTTTGTCTTACTGTAAGTCATACAAGTGTCTGCAGAAGTATAAGCTGT
GGATTGTCCAACAAAGAAAACAGACTTGAAGAAAATGAGATGATCAACTTAACTCTTCAT
CCATCCAAAAAGAGTGGGCCTCAGGTGAAACTCTCTGGCAGCCATAAATGGAGTTATTCA
TTCATCAAAAAACACAGAAGAAGATATAGCAAGAAGACAGCATGTGTGTTACCTGCTCCA
GAAAGACCTTCTCAAGAGAACCACTCCAGAATACTTCCAGAAAACTTTGGCTCTGTAAGA
AGTCAGCTCTCTTCATCCAGTAAGTTCATACCAGGGGTCCCCACTTGCTTTGAGATAAAA
CCTGAAGAAAATTCAGATGTTCATGAATTGAGAGTAAAACGTTCTGTTACAAGAATAAAA
AAGAGATCTCGAAGTGTTTTCTACAGACTGACCATACTGATATTAGTATTTGCTGTTAGT
TGGATGCCACTACACCTTTTCCATGTGGTAACTGATTTTAATGACAATCTTATTTCAAAT
AGGCATTTCAAGTTGGTGTATTGCATTTGTCATTTGTTGGGCATGATGTCCTGTTGTCTT
AATCCAATTCTATATGGGTTTCTTAATAATGGGATTAAAGCTGATTTAGTGTCCCTTATA
CACTGTCTTCATATGTAA
GenBank Gene IDU56079
GeneCard IDNot Available
GenAtlas IDNPY5R
HGNC IDHGNC:7958
Chromosome Location4
Locus4q31-q32
References
  1. Hu Y, Bloomquist BT, Cornfield LJ, DeCarr LB, Flores-Riveros JR, Friedman L, Jiang P, Lewis-Higgins L, Sadlowski Y, Schaefer J, Velazquez N, McCaleb ML: Identification of a novel hypothalamic neuropeptide Y receptor associated with feeding behavior. J Biol Chem. 1996 Oct 18;271(42):26315-9. 8824284
  2. Gerald C, Walker MW, Criscione L, Gustafson EL, Batzl-Hartmann C, Smith KE, Vaysse P, Durkin MM, Laz TM, Linemeyer DL, Schaffhauser AO, Whitebread S, Hofbauer KG, Taber RI, Branchek TA, Weinshank RL: A receptor subtype involved in neuropeptide-Y-induced food intake. Nature. 1996 Jul 11;382(6587):168-71. 8700207
  3. Herzog H, Darby K, Ball H, Hort Y, Beck-Sickinger A, Shine J: Overlapping gene structure of the human neuropeptide Y receptor subtypes Y1 and Y5 suggests coordinate transcriptional regulation. Genomics. 1997 May 1;41(3):315-9. 9169127
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334