You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit alpha-6
SynonymsNot Available
Gene NameCHRNA6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006907|Neuronal acetylcholine receptor subunit alpha-6
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
Number of residues494
Molecular Weight56897.745
Theoretical pI6.6
GO Classification
Functions
  • acetylcholine-activated cation-selective channel activity
  • acetylcholine receptor activity
Processes
  • transport
  • signal transduction
  • regulation of dopamine secretion
  • synaptic transmission
  • synaptic transmission, cholinergic
  • neuromuscular synaptic transmission
  • membrane depolarization
  • response to nicotine
  • regulation of membrane potential
  • cation transmembrane transport
  • neurological system process
Components
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • synapse
  • neuron projection
  • acetylcholine-gated channel complex
General FunctionAcetylcholine-activated cation-selective channel activity
Specific FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Pfam Domain Function
Transmembrane Regions240-264 272-290 306-327 466-484
GenBank Protein ID1458118
UniProtKB IDQ15825
UniProtKB Entry NameACHA6_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0012492|Neuronal acetylcholine receptor subunit alpha-6 (CHRNA6)
ATGCTGACCAGCAAGGGGCAGGGATTCCTTCATGGGGGCTTGTGTCTCTGGCTGTGTGTG
TTCACACCTTTCTTTAAAGGCTGTGTGGGCTGTGCAACTGAGGAGAGGCTCTTCCACAAA
CTGTTTTCTCATTACAACCAGTTCATCAGGCCTGTGGAAAACGTTTCCGACCCTGTCACG
GTACACTTTGAAGTGGCCATCACCCAGCTGGCCAACGTGATCTGGAATGATTATAAATTG
CGCTGGGATCCAATGGAATATGATGGCATTGAGACTCTTCGCGTTCCTGCAGATAAGATT
TGGAAGCCCGACATTGTTCTCTATAACAATGCTGTTGGTGACTTCCAAGTAGAAGGCAAA
ACAAAAGCTCTTCTTAAATACAATGGCATGATAACCTGGACTCCACCAGCTATTTTTAAG
AGTTCCTGCCCTATGGATATCACCTTTTTCCCTTTTGATCATCAAAACTGTTCCCTAAAA
TTTGGTTCCTGGACGTATGACAAAGCTGAAATTGATCTTCTAATCATTGGATCAAAAGTG
GATATGAATGATTTTTGGGAAAACAGTGAATGGGAAATCATTGATGCCTCTGGCTACAAA
CATGACATCAAATACAACTGTTGTGAAGAGATATACACAGATATAACCTATTCTTTCTAC
ATTAGAAGATTGCCGATGTTTTACACGATTAATCTGATCATCCCTTGTCTCTTTATTTCA
TTTCTAACCGTGTTGGTCTTTTACCTTCCTTCGGACTGTGGTGAAAAAGTGACGCTTTGT
ATTTCAGTCCTGCTTTCTCTGACTGTGTTTTTGCTGGTCATCACAGAAACCATCCCATCC
ACATCTCTGGTGGTCCCACTGGTGGGTGAGTACCTGCTGTTCACCATGATCTTTGTCACA
CTGTCCATCGTGGTGACTGTGTTTGTGTTGAACATACACTACCGCACCCCAACCACGCAC
ACAATGCCCAGGTGGGTGAAGACAGTTTTCCTGAAGCTGCTGCCCCAGGTCCTGCTGATG
AGGTGGCCTCTGGACAAGACAAGGGGCACAGGCTCTGATGCAGTGCCCAGAGGCCTTGCC
AGGAGGCCTGCCAAAGGCAAGCTTGCAAGCCATGGGGAACCCAGACATCTTAAAGAATGC
TTCCATTGTCACAAATCAAATGAGCTTGCCACAAGCAAGAGAAGATTAAGTCATCAGCCA
TTACAGTGGGTGGTGGAAAATTCGGAGCACTCGCCTGAAGTTGAAGATGTGATTAACAGT
GTTCAGTTCATAGCAGAAAACATGAAGAGCCACAATGAAACCAAGGAGGTAGAAGATGAC
TGGAAATACGTGGCCATGGTGGTGGACAGAGTATTTCTTTGGGTATTTATAATTGTCTGT
GTATTTGGAACTGCAGGGCTATTTCTACAGCCACTACTTGGGAACACAGGAAAATCTTAA
GenBank Gene IDU62435
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:15963
Chromosome Location8
Locus8p11.21
References
  1. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. 8906617
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334