You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, kainate 4
Synonyms
  • EAA1
  • Excitatory amino acid receptor 1
  • GluK4
  • Glutamate receptor KA-1
  • GRIK
  • KA1
Gene NameGRIK4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010583|Glutamate receptor ionotropic, kainate 4
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Number of residues956
Molecular Weight107244.485
Theoretical pI6.71
GO Classification
Functions
  • extracellular-glutamate-gated ion channel activity
  • kainate selective glutamate receptor activity
Processes
  • transport
  • synaptic transmission
  • ion transmembrane transport
  • glutamate receptor signaling pathway
  • synaptic transmission, glutamatergic
  • ionotropic glutamate receptor signaling pathway
Components
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • integral component of plasma membrane
  • dendrite
  • presynaptic membrane
  • kainate selective glutamate receptor complex
General FunctionKainate selective glutamate receptor activity
Specific FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Pfam Domain Function
Transmembrane Regions546-566 624-644 805-825
GenBank Protein ID544590
UniProtKB IDQ16099
UniProtKB Entry NameGRIK4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010584|Glutamate receptor ionotropic, kainate 4 (GRIK4)
ATGCCCCGCGTCTCGGCGCCTTTGGTGCTGCTTCCTGCGTGGCTCGTGATGGTCGCCTGC
AGCCCGCACTCCTTGAGGATCGCTGCTATCTTGGACGACCCCATGGAGTGCAGCAGAGGG
GAGCGGCTCTCCATCACCCTGGCCAAGAACCGCATCAACCGCGCTCCTGAGAGGCTGGGC
AAGGCCAAGGTCGAAGTGGACATCTTTGAGCTTCTCAGAGACAGCGAGTACGAGACTGCA
GAAACCATGTGTCAGATCCTCCCCAAGGGGGTGGTCGCTGTCCTCGGACCATCGTCCAGC
CCAGCCTCCAGCTCCATCATCAGCAACATCTGTGGAGAGAAGGAGGTCCCTCACTTCAAA
GTGGCCCCAGAGGAGTTCGTCAAGTTCCAGTTCCAGAGATTCACAACCCTGAACCTCCAC
CCCAGCAACACTGACATCAGCGTGGCTGTAGCTGGGATCCTGAACTTCTTCAACTGCACC
ACCGCCTGCCTCATCTGTGCCAAAGCAGAATGCCTTTTAAACCTAGAGAAGCTGCTCCGG
CAATTCCTTATCTCCAAGGACACGCTGTCCGTCCGCATGCTGGATGACACCCGGGACCCC
ACCCCGCTCCTCAAGGAGATCCGGGACGACAAGACCGCCACCATCATCATCCACGCCAAC
GCCTCCATGTCCCACACCATCCTCCTGAAGGCAGCCGAACTTGGGATGGTGTCAGCCTAT
TACACATACATCTTCACTAATCTGGAGTTCTCACTCCAGAGAATGGACAGCCTTGTGGAT
GATCGTGTCAACATCCTGGGATTTTCCATTTTCAACCAATCCCATGCTTTCTTCCAAGAG
TTTGCCCAGAGCCTCAACCAGTCCTGGCAGGAGAACTGTGACCATGTGCCCTTCACTGGG
CCTGCGCTCTCCTCGGCCCTGCTGTTTGATGCTGTCTATGCTGTGGTGACTGCGGTGCAG
GAACTGAACCGGAGCCAAGAGATCGGCGTGAAGCCCTTGTCCTGCGGCTCGGCCCAGATC
TGGCAGCACGGCACCAGCCTCATGAACTACCTGCGCATGGTAGAATTGGAAGGTCTTACC
GGCCACATTGAATTCAACAGCAAAGGCCAGAGGTCCAACTACGCTTTGAAAATCTTACAG
TTCACAAGGAATGGTTTTCGGCAGATCGGCCAGTGGCACGTGGCAGAGGGCCTCAGCATG
GACAGCCACCTCTATGCCTCCAACATCTCGGACACTCTCTTCAACACCACCCTGGTCGTC
ACCACCATCCTGGAGAACCCATATTTAATGCTGAAGGGGAACCACCAGGAGATGGAAGGC
AATGACCGCTACGAGGGCTTCTGTGTGGACATGCTCAAGGAGCTGGCAGAGATCCTCCGA
TTCAACTACAAGATCCGCCTGGTTGGGGATGGCGTGTACGGCGTTCCCGAGGCCAACGGC
ACCTGGACGGGAATGGTCGGGGAGCTGATCGCTAGGAAAGCAGATCTGGCTGTGGCAGGC
CTCACCATTACAGCTGAACGGGAGAAGGTGATTGATTTCTCTAAGCCATTCATGACTCTG
GGAATTAGCATTCTTTACCGCGTTCATATGGGACGCAAACCCGGCTATTTCTCCTTCCTG
GACCCATTTTCTCCGGGCGTCTGGCTCTTCATGCTTCTAGCCTATCTGGCCGTCAGCTGT
GTCCTCTTCCTGGTGGCTCGGTTGACGCCCTACGAGTGGTACAGCCCACACCCATGTGCC
CAGGGCCGGTGCAACCTCCTGGTGAACCAGTACTCCCTGGGCAACAGCCTCTGGTTTCCG
GTCGGGGGGTTCATGCAGCAAGGCTCCACCATCGCCCCTCGCGCCTTATCCACCCGCTGT
GTCAGTGGCGTCTGGTGGGCATTCACGCTGATCATCATCTCATCCTACACGGCCAACCTG
GCAGCCTTCCTGACCGTGCAGCGCATGGATGTGCCCATTGAGTCAGTGGATGACCTGGCT
GACCAGACCGCCATTGAATATGGCACAATTCACGGAGGCTCCAGCATGACCTTCTTCCAA
AATTCCCGCTACCAGACCTACCAACGCATGTGGAATTACATGTATTCCAAGCAGCCCAGC
GTGTTCGTGAAGAGCACAGAGGAGGGAATCGCCAGGGTGTTGAATTCCAACTACGCCTTC
CTCCTGGAATCCACCATGAACGAGTACTATCGGCAGCGAAACTGCAACCTCACTCAGATT
GGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTCGGCTCGGTTTTCCGG
GACGAGTTTGATCTGGCCATTCTCCAGCTGCAGGAGAACAACCGCCTGGAGATCCTGAAG
CGCAAATGGTGGGAAGGAGGGAAGTGCCCCAAGGAGGAAGATCACAGAGCTAAAGGCCTG
GGAATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATCGTGGCCATT
TTTATGGCTATGTTGGAGTTTTTATGGACTCTCAGACACTCAGAAGCAACTGAGGTGTCC
GTCTGCCAGGAGATGGTGACCGAGCTGCGCAGCATTATCCTGTGTCAGGACAGTATCCAC
CCCCGCCGGCGGCGCGCCGCAGTCCCGCCGCCCCGGCCCCCCATCCCCGAGGAGCGCCGA
CCGCGGGGCACGGCGACGCTCAGCAACGGGAAGCTGTGCGGGGCAGGGGAGCCCGACCAG
CTCGCGCAGAGACTGGCGCAGGAGGCCGCCCTGGTGGCCCGCGGCTGCACGCACATCCGC
GTCTGCCCCGAGTGCCGCCGCTTCCAGGGCCTGCGGGCACGGCCGTCGCCCGCCCGCAGC
GAGGAGAGCCTGGAGTGGGAGAAAACCACCAACAGCAGCGAGCCCGAGTAG
GenBank Gene IDS67803
GeneCard IDNot Available
GenAtlas IDGRIK4
HGNC IDHGNC:4582
Chromosome Location11
Locus11q22.3
References
  1. Kamboj RK, Schoepp DD, Nutt S, Shekter L, Korczak B, True RA, Rampersad V, Zimmerman DM, Wosnick MA: Molecular cloning, expression, and pharmacological characterization of humEAA1, a human kainate receptor subunit. J Neurochem. 1994 Jan;62(1):1-9. 8263508
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039