You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium voltage-gated channel subfamily A member 10
Synonyms
  • Voltage-gated potassium channel subunit Kv1.8
Gene NameKCNA10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013280|Potassium voltage-gated channel subfamily A member 10
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE
TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
Number of residues511
Molecular Weight57784.47
Theoretical pINot Available
GO Classification
Functions
  • intracellular cyclic nucleotide activated cation channel activity
  • delayed rectifier potassium channel activity
Processes
  • potassium ion transport
  • synaptic transmission
  • potassium ion transmembrane transport
  • protein homooligomerization
Components
  • plasma membrane
  • voltage-gated potassium channel complex
  • integral component of membrane
General FunctionIntracellular cyclic nucleotide activated cation channel activity
Specific FunctionMediates voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. The channel activity is up-regulated by cAMP.
Pfam Domain Function
Transmembrane Regions218-238 271-292 303-323 339-358 375-395 436-456
GenBank Protein IDNot Available
UniProtKB IDQ16322
UniProtKB Entry NameKCA10_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013281|Potassium voltage-gated channel subfamily A member 10 (KCNA10)
ATGGATGTGTGTGGCTGGAAAGAAATGGAGGTTGCGCTGGTCAATTTTGATAATTCAGAT
GAAATCCAAGAAGAGCCAGGCTATGCCACAGACTTCGACTCAACCAGCCCAAAAGGCCGG
CCTGGGGGCAGCTCCTTCTCCAACGGGAAGATCCTCATCAGCGAAAGCACCAACCATGAG
ACGGCCTTCTCCAAGCTTCCGGGAGACTATGCTGACCCCCCAGGGCCTGAGCCAGTGGTC
CTAAATGAAGGAAACCAGCGGGTGATCATCAACATTGCTGGGCTGAGATTTGAGACCCAG
CTCAGAACCCTTAGTCAGTTCCCAGAGACTCTCCTGGGAGACCGGGAAAAAAGGATGCAG
TTCTTTGACTCCATGAGAAATGAGTATTTCTTTGATCGGAACCGGCCCAGTTTTGATGGA
ATCCTATATTATTACCAATCTGGTGGGAAAATTCGGCGCCCAGCCAATGTTCCCATTGAT
ATCTTTGCTGATGAAATCTCCTTCTATGAGCTGGGTAGTGAGGCCATGGACCAGTTCCGG
GAGGATGAAGGCTTCATCAAAGACCCTGAAACACTGCTACCCACCAATGACATCCACCGT
CAGTTCTGGCTCCTCTTTGAGTACCCTGAAAGTTCCAGCGCTGCCCGTGCTGTGGCCGTG
GTCTCGGTGTTGGTTGTGGTCATCTCCATCACCATCTTCTGCCTGGAGACACTGCCAGAG
TTCCGGGAGGATAGGGAGCTAAAGGTGGTCAGAGACCCCAATCTCAACATGAGCAAGACA
GTCCTCTCCCAGACCATGTTCACCGACCCTTTCTTCATGGTGGAGTCTACCTGCATCGTG
TGGTTCACCTTCGAGCTGGTGCTCCGGTTCGTGGTCTGCCCCAGCAAGACTGACTTCTTC
AGGAACATCATGAACATCATTGACATCATCTCCATTATCCCCTACTTTGCAACTCTCATC
ACAGAGCTAGTCCAGGAGACAGAGCCGAGTGCCCAACAGAACATGTCCCTGGCCATCCTG
AGGATCATCCGCCTGGTGAGGGTCTTCCGCATCTTCAAGCTCTCGCGCCACTCCAAGGGG
CTGCAGATCCTCGGGCAAACACTGAAGGCGTCCATGCGGGAGTTGGGGTTGCTCATCTTC
TTTCTCTTCATTGGAGTCATCCTCTTCTCCAGTGCAGTCTACTTTGCTGAGGTGGATGAG
CCAGAGTCCCATTTCTCTAGCATTCCTGATGGCTTCTGGTGGGCAGTGGTCACCATGACA
ACTGTAGGCTATGGGGACATGTGCCCGACCACCCCAGGGGGGAAGATTGTGGGCACTCTG
TGTGCCATTGCAGGGGTCCTCACCATTGCCCTCCCTGTGCCTGTCATTGTCTCCAACTTC
AATTACTTCTACCACCGGGAGACTGAGAATGAAGAAAAGCAGAACATCCCAGGAGAAATT
GAAAGAATCCTCAACAGTGTAGGCTCAAGAATGGGCAGCACAGACTCTCTTAATAAGACC
AATGGTGGCTGTTCCACAGAGAAGTCTAGGAAATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6219
Chromosome Location1
LocusNot Available
References
  1. Orias M, Bray-Ward P, Curran ME, Keating MT, Desir GV: Genomic localization of the human gene for KCNA10, a cGMP-activated K channel. Genomics. 1997 May 15;42(1):33-7. 9177773
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Lang R, Lee G, Liu W, Tian S, Rafi H, Orias M, Segal AS, Desir GV: KCNA10: a novel ion channel functionally related to both voltage-gated potassium and CNG cation channels. Am J Physiol Renal Physiol. 2000 Jun;278(6):F1013-21. 10836990
  5. Tian S, Liu W, Wu Y, Rafi H, Segal AS, Desir GV: Regulation of the voltage-gated K+ channel KCNA10 by KCNA4B, a novel beta-subunit. Am J Physiol Renal Physiol. 2002 Jul;283(1):F142-9. 12060596
  6. Yao X, Tian S, Chan HY, Biemesderfer D, Desir GV: Expression of KCNA10, a voltage-gated K channel, in glomerular endothelium and at the apical membrane of the renal proximal tubule. J Am Soc Nephrol. 2002 Dec;13(12):2831-9. 12444201
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974