You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, kainate 5
Synonyms
  • EAA2
  • Excitatory amino acid receptor 2
  • GluK5
  • Glutamate receptor KA-2
  • GRIK2
  • KA2
Gene NameGRIK5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037087|Glutamate receptor ionotropic, kainate 5
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE
Number of residues980
Molecular Weight109263.695
Theoretical pI8.03
GO Classification
Functions
  • extracellular-glutamate-gated ion channel activity
  • kainate selective glutamate receptor activity
Processes
  • receptor clustering
  • ionotropic glutamate receptor signaling pathway
  • cellular response to glucose stimulus
  • synaptic transmission
  • establishment of localization in cell
  • positive regulation of neuron apoptotic process
  • ion transmembrane transport
  • protein retention in ER lumen
  • regulation of synaptic vesicle fusion to presynaptic membrane
  • excitatory postsynaptic potential
  • synaptic transmission, glutamatergic
Components
  • postsynaptic membrane
  • endoplasmic reticulum
  • plasma membrane
  • cell junction
  • dendrite
  • postsynaptic density
  • perikaryon
  • presynaptic membrane
  • terminal bouton
  • kainate selective glutamate receptor complex
General FunctionKainate selective glutamate receptor activity
Specific FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds kainate > quisqualate > domoate > L-glutamate >> AMPA >> NMDA = 1S,3R-ACPD.
Pfam Domain Function
Transmembrane Regions545-565 623-643 804-824
GenBank Protein ID251840
UniProtKB IDQ16478
UniProtKB Entry NameGRIK5_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010585|Glutamate receptor ionotropic, kainate 5 (GRIK5)
ATGCCGGCTGAGCTGCTGCTGCTGCTGATTGTTGCCTTCGCCAGCCCCAGCTGCCAGGTG
CTCTCATCACTGCGCATGGCTGCAATCCTGGATGATCAGACAGTGTGTGGCCGCGGTGAG
CGTCTGGCCTTGGCCTTGGCCCGGGAGCAGATCAACGGGATCATCGAGGTCCCAGCCAAG
GCCCGAGTGGAAGTAGACATCTTTGAGCTGCAGCGGGACAGCCAGTACGAGACCACGGAC
ACCATGTGTCAGATCTTACCCAAAGGGGTTGTGTCTGTCCTTGGGCCCTCCTCTAGCCCA
GCATCTGCCTCCACCGTGAGCCATATCTGTGGAGAGAAGGAGATCCCCCACATCAAGGTG
GGTCCCGAGGAGACACCCCGCCTTCAGTACCTTCGCTTCGCGTCTGTCAGCCTGTACCCC
AGTAACGAGGACGTCAGCTTGGCGGTCTCCCGAATCCTCAAGTCCTTCAACTACCCCTCG
GCCAGCCTCATCTGCGCCAAGGCTGAGTGCCTGCTGCGATTGGAGGAACTGGTGCGTGGC
TTCCTCATCTCCAAGGAGACGCTGTCAGTGAGGATGTTGGACGACAGCCGGGACCCCACA
CCACTGCTCAAGGAGATCCGTGATGACAAGGTGTCCACCATCATCATCGACGCCAACGCC
TCCATCTCCCACCTCATCCTCCGTAAGGCCTCGGAACTGGGAATGACCTCAGCGTTTTAC
AAGTACATCCTCACCACCATGGACTTCCCCATCCTGCATCTGGACGGTATTGTGGAGGAC
TCCTCCAACATCCTGGGCTTCTCCATGTTCAACACGTCCCACCCCTTCTACCCTGAGTTT
GTCCGCAGCCTCAACATGTCCTGGAGGGAGAACTGTGAAGCCAGCACCTACCTGGGCCCT
GCGCTGTCAGCCGCCCTGATGTTTGACGCCGTGCACGTGGTGGTGAGCGCTGTCCGAGAG
CTGAACCGCAGCCAGGAGATCGGTGTGAAGCCTCTGGCCTGTACATCGGCCAACATTTGG
CCCCACGGGACCAGCCTCATGAACTACCTGCGCATGGTAGAGTATGATGGGCTGACCGGG
CGGGTCGAGTTCAACAGCAAAGGGCAGAGAACCAACTACACCCTGCGCATCCTAGAAAAG
TCCCGGCAGGGCCACCGTGAGATTGGGGTGTGGTACTCTAACCGCACCCTGGCCATGAAT
GCCACCACCCTGGACATCAACCTGTCGCAGACACTGGCCAACAAGACCCTGGTGGTCACA
ACCATCCTGGAGAACCCATACGTCATGCGCCGGCCCAACTTCCAGGCCCTGTCGGGGAAC
GAACGCTTCGAGGGCTTCTGCGTGGACATGCTGCGGGAGCTGGCCGAGCTGCTGCGCTTC
CGCTACCGCCTGCGGTTGGTGGAGGATGGGCTGTACGGGGCGCCCGAGCCCAACGGCTCC
TGGACGGGCATGGTTGGCGAGCTCATCAACCGGAAGGCAGACCTGGCTGTGGCCGCCTTC
ACCATCACAGCTGAGCGGGAGAAGGTCATCGACTTTTCCAAGCCCTTTATGACCCTGGGG
ATCAGCATCCTCTACCGAGTGCACATGGGCCGCAAGCCTGGCTACTTCTCCTTCCTGGAC
CCCTTCTCCCCTGCTGTGTGGCTCTTCATGCTTCTTGCCTACCTGGCTGTCAGCTGCGTC
CTGTTTCTGGCTGCCAGGCTGAGCCCCTATGAGTGGTATAACCCACACCCATGCCTGCGG
GCACGCCCCCACATCCTGGAGAACCAGTACACGCTGGGCAACAGCCTGTGGTTTCCCGTG
GGGGGCTTCATGCAGCAGGGCTCGGAGATCATGCCCCGGGCGCTGTCCACGCGCTGTGTC
AGCGGAGTCTGGTGGGCCTTCACCTTGATCATCATCTCCTCCTACACGGCCAACCTGGCC
GCCTTCCTCACCGTGCAGCGCATGGAGGTGCCTGTGGAGTCGGCCGATGACCTGGCAGAT
CAGACCAACATCGAGTATGGCACCATCCACGCCGGCTCCACCATGACCTTCTTCCAGAAT
TCACGGTACCAAACGTACCAGCGCATGTGGAACTACATGCAGTCGAAGCAGCCCAGCGTG
TTCGTCAAGAGCACAGAAGAGGGCATTGCCCGCGTCCTCAACTCCCGCTACGCCTTCCTG
CTCGAGTCCACCATGAACGAATACCACCGGCGCCTCAACTGCAACCTCACCCAGATCGGG
GGACTCCTCGACACCAAGGGCTACGGCATTGGCATGCCGCTGGGCTCCCCGTTCCGGGAT
GAGATCACACTGGCCATCCTGCAGCTTCAGGAGAACAACCGGCTGGAGATCCTGAAGCGC
AAGTGGTGGGAGGGGGGCCGGTGCCCCAAGGAGGAGGACCATCGAGCTAAAGGTTTGGGC
ATGGAGAACATTGGTGGCATTTTTATCGTGCTCATCTGTGGCCTCATCATTGCTGTCTTC
GTGGCGGTCATGGAATTCATATGGTCCACACGGAGGTCAGCTGAGTCCGAGGAGACCCCA
GCTCTGCATCCAGCTGCCTGCCAGTGTTCTGCACTTGGCCCAAGGACTCCTCTGAAGGAG
CCGTCCATGCTGCTAGTAAAGGTGCCCTCCACCCGTGTCCAGGTTGCCTTCTCAAGGACA
TCCCTCCGGCAAGTCTGTCCTTTCCTCCTGCAGCATCAGTTGTCCTCTCTTTATTGGATT
CAGGCCACCAACGTACAAATATGCTGTCATTTCTCCAGTCTTAAACCCTCTCCTGACCTC
ACTTTCCCTCCCAGCCACCGCCCACTTTCTTCCCTTCTCTTTACAGCCTTGGCAGCAGTG
GGGGGTCTCCCTGATGCTTCCAGTTTCTTCTTTCCTCCCATTTCCTCTTGCCCCCCACTC
CAGTCTGGCATCGGTCCCTGCCACTCCACTGAAGCCACTCTTGTCACCAGCAACTTCCAT
GTCTGA
GenBank Gene IDS40369
GeneCard IDNot Available
GenAtlas IDGRIK5
HGNC IDHGNC:4583
Chromosome Location19
Locus19q13.2
References
  1. Kamboj RK, Schoepp DD, Nutt S, Shekter L, Korczak B, True RA, Zimmerman DM, Wosnick MA: Molecular structure and pharmacological characterization of humEAA2, a novel human kainate receptor subunit. Mol Pharmacol. 1992 Jul;42(1):10-5. 1321949