You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProprotein convertase subtilisin/kexin type 7
Synonyms
  • 3.4.21.-
  • hPC8
  • LPC
  • Lymphoma proprotein convertase
  • PC7
  • PC8
  • Prohormone convertase 7
  • Proprotein convertase 7
  • Proprotein convertase 8
  • SPC7
  • Subtilisin/kexin-like protease PC7
Gene NamePCSK7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017837|Proprotein convertase subtilisin/kexin type 7
MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLES
LEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAV
LAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESF
QVGILRQWQLTLYGSVWSAVDIRDRQRLLESAMSGKYLHDDFALPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCRSGPCHWPHRSRKAKEEGTEL
ESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCPHQHLDVPHGK
EEQIC
Number of residues785
Molecular Weight86246.44
Theoretical pINot Available
GO Classification
Functions
  • peptidase activity
  • serine-type endopeptidase activity
Processes
  • peptide hormone processing
  • protein processing
Components
  • integral component of Golgi membrane
General FunctionSerine-type endopeptidase activity
Specific FunctionLikely to represent a ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RXXX[KR]R consensus motif.
Pfam Domain Function
Transmembrane Regions668-688
GenBank Protein IDNot Available
UniProtKB IDQ16549
UniProtKB Entry NamePCSK7_HUMAN
Cellular LocationGolgi apparatus
Gene sequence
>lcl|BSEQ0017838|Proprotein convertase subtilisin/kexin type 7 (PCSK7)
ATGCCGAAGGGGAGGCAGAAAGTGCCACACTTGGATGCCCCCCTGGGCCTGCCCACCTGC
CTCTGGCTGGAATTAGCCGGGCTCTTCTTACTGGTTCCCTGGGTCATGGGCCTGGCAGGG
ACAGGTGGGCCTGATGGCCAGGGCACAGGGGGGCCGAGCTGGGCTGTGCACCTGGAAAGC
CTGGAAGGTGACGGGGAGGAAGAGACTCTGGAGCAGCAGGCGGATGCCTTGGCCCAGGCA
GCAGGGCTGGTGAATGCTGGACGCATCGGAGAGCTTCAGGGGCACTACCTCTTTGTCCAG
CCTGCTGGGCACAGGCCGGCCCTGGAGGTGGAGGCCATCCGGCAGCAGGTGGAGGCTGTG
TTGGCTGGGCATGAAGCTGTGCGCTGGCACTCAGAGCAGAGGCTGCTAAGGCGGGCCAAG
CGCAGCGTCCACTTCAACGACCCCAAGTACCCGCAGCAATGGCACCTGAATAACCGACGG
AGCCCGGGCAGGGACATCAACGTGACGGGTGTGTGGGAACGCAATGTGACTGGGCGAGGG
GTGACGGTGGTGGTAGTGGATGACGGAGTGGAACACACCATCCAGGACATTGCACCCAAC
TATAGCCCTGAGGGTAGCTATGACCTCAACTCTAATGACCCTGACCCCATGCCCCACCCG
GATGTGGAGAATGGCAACCACCATGGCACGCGATGTGCAGGAGAGATCGCGGCTGTGCCC
AACAACAGCTTCTGTGCCGTGGGCGTGGCCTACGGGAGCCGCATCGCAGGTATCCGGGTA
CTGGATGGACCTCTCACAGACAGCATGGAGGCAGTGGCGTTCAACAAGCACTATCAGATC
AATGACATCTACAGCTGCAGCTGGGGACCAGATGACGATGGGAAGACAGTGGATGGCCCC
CATCAGCTTGGAAAGGCTGCCTTACAACATGGGGTGATTGCTGGTCGCCAGGGCTTTGGG
AGCATCTTTGTGGTAGCCAGTGGCAACGGAGGCCAACACAACGACAACTGCAACTACGAT
GGCTACGCCAACTCCATCTACACCGTCACCATAGGAGCTGTGGATGAGGAGGGACGCATG
CCTTTCTATGCAGAAGAATGTGCCTCCATGCTGGCAGTCACCTTCAGTGGTGGGGACAAG
ATGCTTCGGAGCATTGTGACCACTGACTGGGACCTTCAGAAGGGCACTGGCTGCACTGAG
GGCCACACAGGGACCTCAGCTGCAGCGCCTCTGGCAGCTGGCATGATAGCCTTAATGCTG
CAGGTGCGGCCCTGCCTCACGTGGCGTGACGTCCAGCACATCATTGTCTTCACAGCCACC
CGGTATGAGGATCGCCGTGCAGAGTGGGTCACCAACGAGGCAGGCTTCAGCCATAGCCAC
CAGCACGGTTTCGGCCTCCTCAACGCCTGGAGGCTCGTGAATGCAGCCAAGATCTGGACA
TCTGTCCCTTACTTAGCATCCTACGTCAGTCCCGTGTTAAAAGAAAACAAGGCGATTCCG
CAGTCCCCCCGTTCCCTGGAGGTCCTGTGGAATGTCAGCAGGATGGACCTGGAGATGTCA
GGGCTGAAGACCCTGGAGCATGTGGCAGTGACAGTCTCCATCACTCACCCACGGCGCGGC
AGCTTGGAGCTGAAGCTGTTCTGCCCCAGTGGCATGATGTCCCTCATCGGCGCCCCCCGC
AGCATGGACTCGGATCCCAACGGCTTCAATGACTGGACCTTCTCCACTGTGCGATGCTGG
GGGGAGAGAGCCCGAGGGACCTACAGGCTTGTCATCAGGGATGTCGGGGATGAGTCATTC
CAGGTCGGCATCCTCCGGCAATGGCAGCTGACCCTATATGGCTCTGTGTGGAGTGCAGTA
GACATCAGGGACAGACAAAGGCTGTTAGAGAGTGCCATGAGTGGAAAATACCTGCACGAT
GACTTCGCCCTGCCCTGCCCACCGGGGCTGAAAATTCCTGAGGAAGATGGTTACACCATC
ACCCCCAACACCCTCAAGACCCTGGTGCTGGTAGGCTGTTTCACCGTCTTCTGGACTGTT
TACTACATGCTGGAAGTATATTTGAGCCAGAGGAATGTGGCTTCCAATCAAGTTTGTAGG
AGTGGACCCTGCCACTGGCCCCATCGGAGCCGGAAAGCCAAGGAGGAAGGGACAGAGCTA
GAATCAGTGCCACTTTGCAGCAGCAAGGATCCAGACGAAGTGGAAACAGAGAGCAGGGGC
CCTCCCACCACCTCTGACCTCCTTGCCCCAGACCTGCTGGAGCAAGGGGACTGGAGCCTG
TCCCAGAACAAGAGCGCCCTGGACTGCCCTCATCAGCACCTAGACGTACCGCACGGGAAG
GAGGAGCAGATCTGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8748
Chromosome Location11
LocusNot Available
References
  1. Bruzzaniti A, Goodge K, Jay P, Taviaux SA, Lam MH, Berta P, Martin TJ, Moseley JM, Gillespie MT: PC8 [corrected], a new member of the convertase family. Biochem J. 1996 Mar 15;314 ( Pt 3):727-31. 8615762
  2. Meerabux J, Yaspo ML, Roebroek AJ, Van de Ven WJ, Lister TA, Young BD: A new member of the proprotein convertase gene family (LPC) is located at a chromosome translocation breakpoint in lymphomas. Cancer Res. 1996 Feb 1;56(3):448-51. 8564950
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Lecointe N, Meerabux J, Ebihara M, Hill A, Young BD: Molecular analysis of an unstable genomic region at chromosome band 11q23 reveals a disruption of the gene encoding the alpha2 subunit of platelet-activating factor acetylhydrolase (Pafah1a2) in human lymphoma. Oncogene. 1999 May 6;18(18):2852-9. 10362256
  6. van de Loo JW, Creemers JW, Bright NA, Young BD, Roebroek AJ, Van de Ven WJ: Biosynthesis, distinct post-translational modifications, and functional characterization of lymphoma proprotein convertase. J Biol Chem. 1997 Oct 24;272(43):27116-23. 9341152