Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePlasma membrane calcium-transporting ATPase 3
Synonyms
  • 3.6.3.8
  • Plasma membrane calcium ATPase isoform 3
  • Plasma membrane calcium pump isoform 3
  • PMCA3
Gene NameATP2B3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008759|Plasma membrane calcium-transporting ATPase 3
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
Number of residues1220
Molecular Weight134196.025
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • calcium-transporting ATPase activity
  • metal ion binding
  • PDZ domain binding
Processes
  • cellular calcium ion homeostasis
  • blood coagulation
  • cation transmembrane transport
  • transmembrane transport
  • ion transmembrane transport
  • transport
Components
  • plasma membrane
  • Golgi apparatus
  • integral component of plasma membrane
  • extracellular vesicle
General FunctionPdz domain binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
Pfam Domain Function
Transmembrane Regions98-118 156-176 365-384 418-435 850-869 880-900 921-943 962-983 1003-1024 1035-1056
GenBank Protein IDNot Available
UniProtKB IDQ16720
UniProtKB Entry NameAT2B3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013399|Plasma membrane calcium-transporting ATPase 3 (ATP2B3)
ATGGGCGACATGGCCAATAGTTCCATCGAGTTCCACCCCAAGCCCCAGCAGCAGCGGGAT
GTCCCCCAGGCTGGAGGCTTTGGGTGCACGCTGGCGGAGCTGCGCACCCTCATGGAGCTG
CGAGGGGCCGAGGCGCTGCAGAAGATCGAGGAGGCCTACGGGGATGTCAGCGGGCTCTGC
CGGAGGCTGAAGACCTCACCCACAGAGGGCCTGGCGGACAACACCAATGACCTGGAGAAG
CGCAGGCAGATCTACGGGCAGAACTTCATCCCCCCAAAGCAACCCAAGACCTTCCTGCAG
CTGGTGTGGGAGGCCCTGCAGGACGTGACCCTCATCATCCTGGAGGTGGCTGCCATCGTC
TCTCTGGGCCTCTCGTTCTATGCGCCGCCAGGAGAGGAGAGTGAAGCCTGTGGGAATGTG
TCGGGAGGCGCAGAAGATGAGGGCGAGGCCGAAGCTGGCTGGATCGAGGGGGCTGCCATC
CTGCTGTCCGTCATCTGTGTGGTGCTGGTCACGGCCTTCAATGACTGGAGCAAGGAGAAG
CAGTTCCGAGGCCTGCAGAGCCGAATTGAGCAGGAGCAGAAGTTCACGGTCATCCGGAAC
GGGCAGCTCCTCCAGGTCCCCGTGGCTGCGCTGGTGGTGGGGGACATTGCCCAGGTCAAG
TACGGCGACCTGCTGCCAGCCGACGGCGTGCTCATCCAGGCCAATGACCTCAAGATCGAC
GAGAGCTCCCTGACGGGCGAGTCTGACCACGTGCGCAAGTCAGCTGACAAAGATCCCATG
CTGCTCTCAGGCACTCATGTCATGGAAGGTTCTGGAAGAATGGTGGTGACCGCCGTTGGC
GTGAATTCCCAGACAGGCATCATCTTCACGCTGCTTGGAGCTGGCGGAGAGGAGGAAGAG
AAGAAAGATAAGAAAGGCAAGCAGCAGGATGGGGCCATGGAGAGTAGCCAGACCAAAGCT
AAGAAGCAGGATGGTGCAGTGGCCATGGAGATGCAGCCCCTGAAGAGCGCGGAGGGTGGG
GAGATGGAGGAGCGGGAGAAGAAGAAAGCCAACGCACCCAAAAAGGAGAAGTCTGTCCTT
CAGGGGAAGCTCACAAAGCTAGCCGTGCAGATCGGGAAAGCAGGGCTGGTGATGTCTGCC
ATCACCGTCATCATCCTGGTCCTCTACTTTGTGATTGAGACGTTTGTCGTGGAAGGCCGG
ACATGGCTGGCAGAGTGCACGCCGGTCTATGTACAATACTTCGTGAAGTTCTTCATCATT
GGTGTCACTGTGCTGGTCGTGGCTGTCCCAGAGGGCCTGCCTCTTGCTGTCACCATCTCC
TTAGCTTACTCTGTCAAGAAAATGATGAAAGACAACAACCTGGTGCGCCACCTGGATGCC
TGCGAGACCATGGGCAACGCCACAGCCATCTGCTCCGACAAGACGGGCACGCTCACCACC
AACCGTATGACCGTGGTCCAGTCCTACCTAGGAGACACCCACTACAAAGAGATTCCGGCC
CCCAGCGCCCTGACCCCTAAGATCCTCGACCTCCTGGTCCATGCCATCTCCATCAACAGT
GCCTATACCACCAAAATACTACCTCCTGAGAAGGAAGGCGCCCTCCCACGCCAGGTGGGC
AATAAGACGGAGTGCGCCCTGCTGGGCTTCGTCTTGGACCTGAAGCGGGACTTCCAGCCC
GTGCGCGAGCAGATCCCGGAAGACAAGCTTTACAAAGTGTACACCTTCAACTCGGTCCGC
AAGTCCATGAGCACAGTCATCCGCATGCCCGACGGTGGCTTCCGCCTCTTCAGCAAGGGG
GCCTCAGAGATCCTCTTGAAAAAGTGCACCAACATCTTGAACAGCAATGGCGAACTCCGG
GGCTTTCGGCCTCGGGACCGGGACGACATGGTGAGGAAGATCATCGAGCCGATGGCTTGC
GATGGCCTCCGCACCATCTGCATCGCCTACCGGGACTTCTCTGCAGGCCAGGAGCCCGAC
TGGGACAACGAGAATGAGGTCGTGGGTGACCTCACCTGCATAGCTGTCGTGGGCATTGAG
GACCCTGTGCGGCCCGAGGTCCCTGAAGCTATCCGAAAATGCCAGCGTGCTGGCATCACA
GTCCGCATGGTGACTGGGGACAACATCAACACGGCCCGGGCCATCGCAGCCAAATGCGGC
ATCATCCAGCCCGGGGAGGACTTCCTGTGCCTAGAAGGGAAGGAGTTCAACCGGCGGATC
CGCAATGAGAAAGGCGAGATAGAACAGGAGCGGCTGGACAAGGTGTGGCCCAAGCTGAGG
GTGCTGGCCCGGTCGTCTCCCACCGACAAGCACACACTGGTCAAAGGGATTATCGACAGC
ACCACTGGTGAGCAGCGGCAGGTGGTGGCTGTGACAGGGGATGGCACCAACGATGGGCCG
GCCCTCAAGAAGGCGGACGTGGGCTTCGCCATGGGCATCGCAGGGACCGACGTGGCCAAG
GAGGCCTCCGACATCATCCTGACCGATGACAACTTCACCAGCATCGTCAAGGCAGTCATG
TGGGGCCGTAACGTCTATGACAGCATCTCCAAGTTCCTGCAGTTTCAACTGACGGTCAAT
GTGGTGGCTGTGATCGTGGCCTTCACAGGTGCCTGCATTACTCAGGACTCTCCTCTCAAA
GCCGTGCAGATGTTGTGGGTGAACTTGATCATGGACACATTTGCCTCTCTGGCCCTGGCG
ACGGAGCCACCCACAGAGTCGCTGCTGCTGCGGAAGCCGTACGGCCGCGACAAGCCCCTC
ATCTCCCGCACCATGATGAAGAACATTCTGGGCCACGCCGTGTACCAGCTCGCCATCATC
TTCACCCTGCTGTTTGTCGGGGAGCTCTTCTTCGACATCGACAGCGGGAGGAATGCGCCC
CTGCACTCGCCACCCTCAGAGCACTACACCATCATCTTCAACACGTTCGTCATGATGCAG
CTCTTTAACGAGATCAACGCCCGCAAGATCCACGGCGAGAGGAACGTGTTCGACGGCATC
TTCAGCAACCCCATCTTCTGCACCATCGTTTTGGGCACTTTCGGGATTCAGATTGTCATC
GTCCAGTTTGGCGGGAAGCCCTTCAGCTGCTCCCCACTATCCACAGAACAGTGGCTCTGG
TGCCTGTTTGTTGGTGTTGGGGAGCTGGTCTGGGGACAGGTCATTGCCACCATCCCCACC
AGCCAGCTCAAGTGCCTGAAGGAAGCCGGGCACGGGCCCGGGAAGGACGAGATGACCGAC
GAGGAGCTGGCCGAAGGCGAGGAAGAGATCGACCATGCCGAGCGGGAGCTCCGCAGGGGC
CAGATCCTCTGGTTCCGGGGCCTGAACCGGATTCAGACGCAGATCCGGGTGGTGAAAGCG
TTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAAC
TTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGAC
GACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAAC
CAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCT
ACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTC
TAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:816
Chromosome LocationX
LocusNot Available
References
  1. Brown BJ, Hilfiker H, DeMarco SJ, Zacharias DA, Greenwood TM, Guerini D, Strehler EE: Primary structure of human plasma membrane Ca(2+)-ATPase isoform 3. Biochim Biophys Acta. 1996 Aug 14;1283(1):10-3. 8765088
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  3. Wang MG, Yi H, Hilfiker H, Carafoli E, Strehler EE, McBride OW: Localization of two genes encoding plasma membrane Ca2+ ATPases isoforms 2 (ATP2B2) and 3 (ATP2B3) to human chromosomes 3p26-->p25 and Xq28, respectively. Cytogenet Cell Genet. 1994;67(1):41-5. 8187550
  4. Mallon AM, Platzer M, Bate R, Gloeckner G, Botcherby MR, Nordsiek G, Strivens MA, Kioschis P, Dangel A, Cunningham D, Straw RN, Weston P, Gilbert M, Fernando S, Goodall K, Hunter G, Greystrong JS, Clarke D, Kimberley C, Goerdes M, Blechschmidt K, Rump A, Hinzmann B, Mundy CR, Miller W, Poustka A, Herman GE, Rhodes M, Denny P, Rosenthal A, Brown SD: Comparative genome sequence analysis of the Bpa/Str region in mouse and Man. Genome Res. 2000 Jun;10(6):758-75. 10854409
  5. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1993 Dec 5;268(34):25993-6003. 8245032
  6. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1994 Dec 16;269(50):32022. 7989379
  7. Goellner GM, DeMarco SJ, Strehler EE: Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants. Ann N Y Acad Sci. 2003 Apr;986:461-71. 12763866
  8. Zanni G, Cali T, Kalscheuer VM, Ottolini D, Barresi S, Lebrun N, Montecchi-Palazzi L, Hu H, Chelly J, Bertini E, Brini M, Carafoli E: Mutation of plasma membrane Ca2+ ATPase isoform 3 in a family with X-linked congenital cerebellar ataxia impairs Ca2+ homeostasis. Proc Natl Acad Sci U S A. 2012 Sep 4;109(36):14514-9. doi: 10.1073/pnas.1207488109. Epub 2012 Aug 21. 22912398