You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase-like N
Synonyms
  • ICA 512
  • ICA3
  • ICA512
  • Islet cell antigen 512
  • Islet cell autoantigen 3
  • PTP IA-2
  • R-PTP-N
Gene NamePTPRN
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009012|Receptor-type tyrosine-protein phosphatase-like N
MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAEL
LPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEA
PALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQG
SSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTL
LTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSE
VQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKP
LSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ
Number of residues979
Molecular Weight105846.52
Theoretical pINot Available
GO Classification
Functions
  • phosphatase activity
  • spectrin binding
Processes
  • response to reactive oxygen species
  • luteinization
  • response to cAMP
  • insulin secretion involved in cellular response to glucose stimulus
  • dense core granule maturation
  • response to estrogen
  • cytokine-mediated signaling pathway
  • response to insulin
  • protein dephosphorylation
  • insulin secretion
Components
  • cell junction
  • integral component of membrane
  • secretory granule
  • axon terminus
  • synapse
  • endosome
  • perikaryon
  • neuronal cell body
  • transport vesicle membrane
  • plasma membrane
General FunctionSpectrin binding
Specific FunctionPlays a role in vesicle-mediated secretory processes (PubMed:24843546). Required for normal accumulation of secretory vesicles in hippocampus, pituitary and pancreatic islets (By similarity). Required for the accumulation of normal levels of insulin-containing vesicles and preventing their degradation (PubMed:24843546). Plays a role in insulin secretion in response to glucose stimuli (PubMed:24843546). Required for normal accumulation of the neurotransmitters norepinephrine, dopamine and serotonin in the brain (By similarity). In females, but not in males, required for normal accumulation and secretion of pituitary hormones, such as luteinizing hormone (LH) and follicle-stimulating hormone (FSH) (By similarity). Seems to lack intrinsic enzyme activity (By similarity).
Pfam Domain Function
Transmembrane Regions576-600
GenBank Protein IDNot Available
UniProtKB IDQ16849
UniProtKB Entry NamePTPRN_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0017667|Receptor-type tyrosine-protein phosphatase-like N (PTPRN)
ATGCGGCGCCCGCGGCGGCCTGGGGGTCTCGGGGGATCCGGGGGTCTCCGGCTGCTCCTC
TGCCTCCTGCTGCTGAGCAGCCGCCCGGGGGGCTGCAGCGCCGTTAGTGCCCACGGCTGT
CTATTTGACCGCAGGCTCTGCTCTCACCTGGAAGTCTGTATTCAGGATGGCTTGTTTGGG
CAGTGCCAGGTGGGAGTGGGGCAGGCCCGGCCCCTTTTGCAAGTCACCTCCCCAGTTCTC
CAACGCTTACAAGGTGTGCTCCGACAACTCATGTCCCAAGGATTGTCCTGGCACGATGAC
CTCACCCAGTATGTGATCTCTCAGGAGATGGAGCGCATCCCCAGGCTTCGCCCCCCAGAG
CCCCGTCCAAGGGACAGGTCTGGCTTGGCACCCAAGAGACCTGGTCCTGCTGGAGAGCTG
CTTTTACAGGACATCCCCACTGGCTCCGCCCCTGCTGCCCAGCATCGGCTTCCACAACCA
CCAGTGGGCAAAGGTGGAGCTGGGGCCAGCTCCTCTCTGTCCCCTCTGCAGGCTGAGCTG
CTCCCGCCTCTCTTGGAGCACCTGCTGCTGCCCCCACAGCCTCCCCACCCTTCACTGAGT
TACGAACCTGCCTTGCTGCAGCCCTACCTGTTCCACCAGTTTGGCTCCCGTGATGGCTCC
AGGGTCTCAGAGGGCTCCCCAGGGATGGTCAGTGTCGGCCCCCTGCCCAAGGCTGAAGCC
CCTGCCCTCTTCAGCAGAACTGCCTCCAAGGGCATATTTGGGGACCACCCTGGCCACTCC
TACGGGGACCTTCCAGGGCCTTCACCTGCCCAGCTTTTTCAAGACTCTGGGCTGCTCTAT
CTGGCCCAGGAGTTGCCAGCACCCAGCAGGGCCAGGGTGCCAAGGCTGCCAGAGCAAGGG
AGCAGCAGCCGGGCAGAGGACTCCCCAGAGGGCTATGAGAAGGAAGGACTAGGGGATCGT
GGAGAGAAGCCTGCTTCCCCAGCTGTGCAGCCAGATGCGGCTCTGCAGAGGCTGGCCGCT
GTGCTGGCGGGCTATGGGGTAGAGCTGCGTCAGCTGACCCCTGAGCAGCTCTCCACACTC
CTGACCCTGCTGCAGCTACTGCCCAAGGGTGCAGGAAGAAATCCGGGAGGGGTTGTAAAT
GTTGGAGCTGATATCAAGAAAACAATGGAGGGGCCGGTGGAGGGCAGAGACACAGCAGAG
CTTCCAGCCCGCACATCCCCCATGCCTGGACACCCCACTGCCAGCCCTACCTCCAGTGAA
GTCCAGCAGGTGCCAAGCCCTGTCTCCTCTGAGCCTCCCAAAGCTGCCAGACCCCCTGTG
ACACCTGTCCTGCTAGAGAAGAAAAGCCCACTGGGCCAGAGCCAGCCCACGGTGGCAGGA
CAGCCCTCAGCCCGCCCAGCAGCAGAGGAATATGGCTACATCGTCACTGATCAGAATGTG
GTGGGACCAGCCCTCACCTTCCGCATCCGGCACAATGAGCAGAACCTGTCTTTGGCTGAT
GTGACCCAACAAGCAGGGCTGGTGAAGTCTGAACTGGAAGCACAGACAGGGCTCCAAATC
TTGCAGACAGGAGTGGGACAGAGGGAGGAGGCAGCTGCAGTCCTTCCCCAAACTGCGCAC
AGCACCTCACCCATGCGCTCAGTGCTGCTCACTCTGGTGGCCCTGGCAGGTGTGGCTGGG
CTGCTGGTGGCTCTGGCTGTGGCTCTGTGTGTGCGGCAGCATGCGCGGCAGCAAGACAAG
GAGCGCCTGGCAGCCCTGGGGCCTGAGGGGGCCCATGGTGACACTACCTTTGAGTACCAG
GACCTGTGCCGCCAGCACATGGCCACGAAGTCCTTGTTCAACCGGGCAGAGGGTCCACCG
GAGCCTTCACGGGTGAGCAGTGTGTCCTCCCAGTTCAGCGACGCAGCCCAGGCCAGCCCC
AGCTCCCACAGCAGCACCCCGTCCTGGTGCGAGGAGCCGGCCCAAGCCAACATGGACATC
TCCACGGGACACATGATTCTGGCATACATGGAGGATCACCTGCGGAACCGGGACCGCCTT
GCCAAGGAGTGGCAGGCCCTCTGTGCCTACCAAGCAGAGCCAAACACCTGTGCCACCGCG
CAGGGGGAGGGCAACATCAAAAAGAACCGGCATCCTGACTTCCTGCCCTATGACCATGCC
CGCATAAAACTGAAGGTGGAGAGCAGCCCTTCTCGGAGCGATTACATCAACGCCAGCCCC
ATTATTGAGCATGACCCTCGGATGCCAGCCTACATAGCCACGCAGGGCCCGCTGTCCCAT
ACCATCGCAGACTTCTGGCAGATGGTGTGGGAGAGCGGCTGCACCGTCATCGTCATGCTG
ACCCCGCTGGTGGAGGATGGTGTCAAGCAGTGTGACCGCTACTGGCCAGATGAGGGTGCC
TCCCTCTACCACGTATATGAGGTGAACCTGGTGTCGGAGCACATCTGGTGCGAGGACTTT
CTGGTGCGGAGCTTCTACCTGAAGAACGTGCAGACCCAGGAGACGCGCACGCTCACGCAG
TTCCACTTCCTCAGCTGGCCGGCAGAGGGCACACCGGCCTCCACGCGGCCCCTGCTGGAC
TTCCGCAGGAAGGTGAACAAGTGCTACCGGGGCCGCTCCTGCCCCATCATCGTGCACTGC
AGTGATGGTGCGGGGAGGACCGGCACCTACATCCTCATCGACATGGTCCTGAACCGCATG
GCAAAAGGAGTGAAGGAGATTGACATCGCTGCCACCCTGGAGCATGTCCGTGACCAGCGG
CCTGGCCTTGTCCGCTCTAAGGACCAGTTTGAATTTGCCCTGACAGCCGTGGCGGAGGAA
GTGAATGCCATCCTCAAGGCCCTGCCCCAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9676
Chromosome Location2
LocusNot Available
References
  1. Lan MS, Lu J, Goto Y, Notkins AL: Molecular cloning and identification of a receptor-type protein tyrosine phosphatase, IA-2, from human insulinoma. DNA Cell Biol. 1994 May;13(5):505-14. 8024693
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Rabin DU, Pleasic SM, Shapiro JA, Yoo-Warren H, Oles J, Hicks JM, Goldstein DE, Rae PM: Islet cell antigen 512 is a diabetes-specific islet autoantigen related to protein tyrosine phosphatases. J Immunol. 1994 Mar 15;152(6):3183-8. 8144912
  6. Solimena M, Dirkx R Jr, Hermel JM, Pleasic-Williams S, Shapiro JA, Caron L, Rabin DU: ICA 512, an autoantigen of type I diabetes, is an intrinsic membrane protein of neurosecretory granules. EMBO J. 1996 May 1;15(9):2102-14. 8641276
  7. Hermel JM, Dirkx R Jr, Solimena M: Post-translational modifications of ICA512, a receptor tyrosine phosphatase-like protein of secretory granules. Eur J Neurosci. 1999 Aug;11(8):2609-20. 10457160
  8. Ort T, Voronov S, Guo J, Zawalich K, Froehner SC, Zawalich W, Solimena M: Dephosphorylation of beta2-syntrophin and Ca2+/mu-calpain-mediated cleavage of ICA512 upon stimulation of insulin secretion. EMBO J. 2001 Aug 1;20(15):4013-23. 11483505
  9. Hu YF, Zhang HL, Cai T, Harashima S, Notkins AL: The IA-2 interactome. Diabetologia. 2005 Dec;48(12):2576-81. Epub 2005 Nov 5. 16273344
  10. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. 22171320
  11. Harashima S, Horiuchi T, Wang Y, Notkins AL, Seino Y, Inagaki N: Sorting nexin 19 regulates the number of dense core vesicles in pancreatic beta-cells. J Diabetes Investig. 2012 Feb 20;3(1):52-61. doi: 10.1111/j.2040-1124.2011.00138.x. 24843546
  12. Halim A, Ruetschi U, Larson G, Nilsson J: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J Proteome Res. 2013 Feb 1;12(2):573-84. doi: 10.1021/pr300963h. Epub 2013 Jan 11. 23234360
  13. Torkko JM, Primo ME, Dirkx R, Friedrich A, Viehrig A, Vergari E, Borgonovo B, Sonmez A, Wegbrod C, Lachnit M, Munster C, Sica MP, Ermacora MR, Solimena M: Stability of proICA512/IA-2 and its targeting to insulin secretory granules require beta4-sheet-mediated dimerization of its ectodomain in the endoplasmic reticulum. Mol Cell Biol. 2015 Mar;35(6):914-27. doi: 10.1128/MCB.00994-14. Epub 2015 Jan 5. 25561468
  14. Primo ME, Klinke S, Sica MP, Goldbaum FA, Jakoncic J, Poskus E, Ermacora MR: Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2. J Biol Chem. 2008 Feb 22;283(8):4674-81. Epub 2007 Nov 29. 18048354
  15. Almo SC, Bonanno JB, Sauder JM, Emtage S, Dilorenzo TP, Malashkevich V, Wasserman SR, Swaminathan S, Eswaramoorthy S, Agarwal R, Kumaran D, Madegowda M, Ragumani S, Patskovsky Y, Alvarado J, Ramagopal UA, Faber-Barata J, Chance MR, Sali A, Fiser A, Zhang ZY, Lawrence DS, Burley SK: Structural genomics of protein phosphatases. J Struct Funct Genomics. 2007 Sep;8(2-3):121-40. Epub 2007 Dec 5. 18058037