You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMitochondrial 10-formyltetrahydrofolate dehydrogenase
Synonyms
  • 1.5.1.6
  • Aldehyde dehydrogenase family 1 member L2
  • Mitochondrial 10-FTHFDH
Gene NameALDH1L2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008834|Mitochondrial 10-formyltetrahydrofolate dehydrogenase
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Number of residues923
Molecular Weight101744.98
Theoretical pINot Available
GO Classification
Functions
  • methyltransferase activity
  • hydroxymethyl-, formyl- and related transferase activity
  • formyltetrahydrofolate dehydrogenase activity
  • aldehyde dehydrogenase (NAD) activity
Processes
  • one-carbon metabolic process
  • biosynthetic process
  • 10-formyltetrahydrofolate catabolic process
Components
  • mitochondrion
  • extracellular exosome
General FunctionMethyltransferase activity
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ3SY69
UniProtKB Entry NameAL1L2_HUMAN
Cellular LocationMitochondrion
Gene sequence
>lcl|BSEQ0019671|Mitochondrial 10-formyltetrahydrofolate dehydrogenase (ALDH1L2)
ATGCTGCGGCGGGGCAGCCAGGCGCTCCGGCGCTTCTCCACTGGCCGGGTTTATTTCAAA
AACAAGCTGAAGTTGGCACTAATTGGCCAGAGCCTCTTTGGACAAGAAGTCTATAGCCAC
CTCCGCAAAGAGGGCCACCGAGTAGTAGGGGTGTTCACAGTTCCAGACAAGGATGGAAAA
GCTGACCCTCTGGCTTTGGCTGCAGAGAAAGATGGGACCCCTGTGTTCAAGCTTCCTAAA
TGGAGGGTCAAGGGCAAGACCATCAAAGAAGTGGCAGAAGCCTACAGATCCGTGGGTGCA
GAGCTAAATGTGCTCCCTTTCTGCACTCAGTTCATTCCCATGGATATAATTGATAGTCCA
AAGCACGGCTCTATCATTTATCACCCATCCATCCTGCCCAGGCACAGAGGAGCCTCTGCT
ATCAATTGGACTCTAATTATGGGAGATAAGAAAGCTGGGTTTTCTGTTTTCTGGGCTGAT
GATGGCTTGGATACAGGACCCATCCTTCTTCAGAGATCATGTGATGTTGAACCCAATGAT
ACAGTGGATGCACTTTATAATCGGTTTCTTTTTCCTGAAGGAATCAAGGCCATGGTAGAA
GCTGTCCAACTCATAGCTGATGGAAAAGCTCCTCGTATACCCCAGCCAGAAGAAGGGGCA
ACATATGAAGGTATCCAGAAAAAGGAAAATGCTGAGATTTCTTGGGACCAGTCTGCCGAA
GTTTTACATAACTGGATTCGAGGTCATGATAAAGTCCCTGGAGCTTGGACAGAGATAAAT
GGACAGATGGTCACTTTCTATGGCTCGACATTACTGAATAGCTCTGTGCCTCCTGGAGAA
CCACTGGAAATTAAAGGTGCCAAGAAGCCTGGTCTCGTTACCAAAAATGGACTTGTTCTT
TTTGGTAACGATGGAAAAGCACTGACGGTGAGAAATCTGCAGTTTGAAGATGGAAAAATG
ATCCCTGCCTCTCAGTACTTTTCAACGGGTGAGACGTCAGTGGTAGAACTGACAGCTGAA
GAGGTGAAAGTGGCAGAGACCATCAAGGTCATCTGGGCTGGAATTTTAAGCAATGTCCCC
ATTATTGAAGACTCAACAGACTTCTTTAAATCTGGAGCAAGCTCAATGGATGTTGCCAGG
CTGGTTGAAGAGATCAGACAGAAATGTGGTGGGCTTCAGTTGCAGAATGAAGATGTCTAT
ATGGCCACCAAGTTTGAAGGCTTTATCCAAAAGGTCGTGAGGAAACTGAGAGGAGAAGAT
CAAGAGGTGGAGCTGGTTGTAGATTATATTTCAAAGGAGGTCAATGAAATCATGGTAAAA
ATGCCATACCAGTGTTTCATAAATGGACAGTTCACAGATGCAGACGATGGAAAGACTTAC
GACACTATCAACCCAACAGATGGATCTACAATATGCAAAGTATCCTACGCTTCTTTGGCG
GATGTTGATAAAGCAGTAGCAGCAGCAAAAGATGCTTTTGAAAACGGTGAATGGGGAAGA
ATGAATGCAAGAGAAAGAGGAAGATTGATGTATAGACTTGCAGACCTACTGGAAGAGAAC
CAAGAAGAGCTGGCAACTATTGAAGCCCTTGATTCAGGGGCTGTCTATACCTTGGCCCTG
AAGACACACATTGGAATGTCTGTGCAAACATTCAGATATTTTGCTGGCTGGTGCGACAAA
ATTCAGGGTTCTACTATTCCAATCAACCAGGCCCGTCCAAATCGCAATCTGACCTTCACC
AAGAAAGAGCCACTCGGTGTCTGTGCCATTATTATTCCCTGGAACTACCCGCTGATGATG
CTGGCATGGAAGAGTGCTGCGTGTTTGGCAGCAGGCAATACCTTAGTGCTCAAGCCAGCA
CAGGTCACGCCCTTGACTGCTTTGAAGTTTGCAGAACTGTCTGTGAAAGCAGGCTTTCCA
AAGGGGGTCATCAACATCATTCCAGGCTCAGGTGGCATAGCAGGACAACGTCTGTCTGAA
CATCCTGACATCCGCAAACTTGGTTTCACTGGATCCACTCCTATTGGCAAACAGATCATG
AAGAGCTGTGCTGTTAGCAACTTGAAGAAAGTTTCCCTTGAGCTTGGTGGCAAGTCTCCA
CTTATAATATTTAATGACTGTGAACTTGACAAGGCTGTGCGAATGGGCATGGGAGCAGTA
TTTTTCAACAAAGGAGAGAACTGTATTGCTGCTGGGCGGTTGTTCGTGGAAGAATCCATC
CACGACGAATTTGTGACAAGAGTGGTAGAAGAAATTAAAAAGATGAAAATTGGTGATCCA
CTTGACAGATCCACTGATCATGGGCCCCAAAATCATAAGGCTCATCTGGAAAAGCTGCTG
CAATACTGTGAAACTGGAGTGAAAGAAGGGGCCACTTTGGTGTACGGGGGAAGACAAGTC
CAAAGGCCAGGCTTTTTCATGGAGCCGACCGTGTTCACAGATGTGGAAGACTACATGTAC
CTCGCCAAAGAGGAATCCTTTGGGCCTATTATGGTCATTTCTAAATTCCAAAATGGGGAC
ATCGATGGAGTGTTGCAGCGAGCAAATAGTACAGAGTATGGTTTGGCCTCAGGGGTTTTT
ACAAGAGACATAAACAAAGCTATGTATGTGAGTGAAAAACTGGAAGCAGGAACTGTTTTT
ATTAACACATACAACAAGACAGATGTGGCGGCCCCATTTGGCGGAGTTAAACAATCTGGC
TTTGGAAAAGACTTAGGTGAGGAAGCTCTAAATGAATATCTCAAAACCAAGACGGTGACA
CTGGAATATTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:26777
Chromosome Location12
LocusNot Available
References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  4. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  5. Krupenko NI, Dubard ME, Strickland KC, Moxley KM, Oleinik NV, Krupenko SA: ALDH1L2 is the mitochondrial homolog of 10-formyltetrahydrofolate dehydrogenase. J Biol Chem. 2010 Jul 23;285(30):23056-63. doi: 10.1074/jbc.M110.128843. Epub 2010 May 24. 20498374
  6. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712