You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHemoglobin subunit mu
Synonyms
  • HBAP2
  • Hemoglobin mu chain
  • Mu-globin
Gene NameHBM
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017581|Hemoglobin subunit mu
MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQ
RMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQ
MQAAWDKFLTGVAVVLTEKYR
Number of residues141
Molecular Weight15617.97
Theoretical pINot Available
GO Classification
Functions
  • oxygen transporter activity
  • iron ion binding
  • heme binding
  • oxygen binding
Components
  • extracellular exosome
  • hemoglobin complex
General FunctionOxygen transporter activity
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ6B0K9
UniProtKB Entry NameHBM_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0017582|Hemoglobin subunit mu (HBM)
ATGCTCAGCGCCCAGGAGCGCGCCCAAATCGCGCAGGTCTGGGACCTGATTGCGGGCCAC
GAGGCGCAATTCGGGGCGGAGCTGCTGCTCAGGCTCTTCACGGTGTACCCCAGCACCAAG
GTCTACTTCCCGCACCTGAGCGCCTGCCAGGACGCGACGCAGCTGCTGAGCCACGGGCAG
CGCATGCTGGCGGCTGTGGGCGCGGCGGTGCAGCACGTGGACAACCTGCGCGCCGCGCTG
AGCCCGCTGGCGGACCTGCACGCGCTCGTGCTGCGCGTGGACCCAGCCAACTTTCCGCTG
CTAATCCAGTGTTTCCACGTCGTGCTGGCCTCCCACCTGCAGGACGAGTTCACCGTGCAA
ATGCAAGCGGCGTGGGACAAGTTCCTGACTGGTGTGGCCGTGGTGCTGACCGAAAAATAC
CGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4826
Chromosome Location16
LocusNot Available
References
  1. Goh SH, Lee YT, Bhanu NV, Cam MC, Desper R, Martin BM, Moharram R, Gherman RB, Miller JL: A newly discovered human alpha-globin gene. Blood. 2005 Aug 15;106(4):1466-72. Epub 2005 Apr 26. 15855277
  2. De Gobbi M, Viprakasit V, Hughes JR, Fisher C, Buckle VJ, Ayyub H, Gibbons RJ, Vernimmen D, Yoshinaga Y, de Jong P, Cheng JF, Rubin EM, Wood WG, Bowden D, Higgs DR: A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter. Science. 2006 May 26;312(5777):1215-7. 16728641
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334