You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProton-coupled amino acid transporter 1
Synonyms
  • PAT1
  • Proton/amino acid transporter 1
  • Solute carrier family 36 member 1
Gene NameSLC36A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001070|Proton-coupled amino acid transporter 1
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGN
IGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTV
MYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNC
HNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIV
QRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIP
FFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
Number of residues476
Molecular Weight53075.045
Theoretical pI7.0
GO Classification
Functions
  • L-alanine transmembrane transporter activity
  • hydrogen
  • hydrogen ion transmembrane transporter activity
  • L-proline transmembrane transporter activity
  • glycine transmembrane transporter activity
Processes
  • amino acid transport
  • transmembrane transport
  • hydrogen ion transmembrane transport
  • L-alanine transport
  • proline transmembrane transport
  • glycine transport
  • proton transport
  • ion transport
Components
  • endoplasmic reticulum
  • plasma membrane
  • integral component of membrane
  • lysosomal membrane
General FunctionL-proline transmembrane transporter activity
Specific FunctionNeutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid (By similarity).
Pfam Domain Function
Transmembrane Regions52-72 79-99 142-162 191-211 216-236 258-278 290-310 343-363 373-393 398-418 440-460
GenBank Protein ID31324239
UniProtKB IDQ7Z2H8
UniProtKB Entry NameS36A1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0020464|Proton-coupled amino acid transporter 1 (SLC36A1)
ATGTCCACGCAGAGACTTCGGAATGAAGACTACCACGACTACAGCTCCACGGACGTGAGC
CCTGAGGAGAGCCCGTCGGAAGGCCTCAACAACCTCTCCTCCCCGGGCTCCTACCAGCGC
TTTGGTCAAAGCAATAGCACAACATGGTTCCAGACCTTGATCCACCTGTTAAAAGGCAAC
ATTGGCACAGGACTCCTGGGACTCCCTCTGGCGGTGAAAAATGCAGGCATCGTGATGGGT
CCCATCAGCCTGCTGATCATAGGCATCGTGGCCGTGCACTGCATGGGTATCCTGGTGAAA
TGTGCTCACCACTTCTGCCGCAGGCTGAATAAATCCTTTGTGGATTATGGTGATACTGTG
ATGTATGGACTAGAATCCAGCCCCTGCTCCTGGCTCCGGAACCACGCACACTGGGGAAGA
CGTGTTGTGGACTTCTTCCTGATTGTCACCCAGCTGGGATTCTGCTGTGTCTATTTTGTG
TTTCTGGCTGACAACTTTAAACAGGTGATAGAAGCGGCCAATGGGACCACCAATAACTGC
CACAACAATGAGACGGTGATTCTGACGCCTACCATGGACTCGCGACTCTACATGCTCTCC
TTCCTGCCCTTCCTGGTGCTGCTGGTTTTCATCAGGAACCTCCGAGCCCTGTCCATCTTC
TCCCTGTTGGCCAACATCACCATGCTGGTCAGCTTGGTCATGATCTACCAGTTCATTGTT
CAGAGGATCCCAGACCCCAGCCACCTCCCCTTGGTGGCCCCTTGGAAGACCTACCCTCTC
TTCTTTGGCACAGCGATTTTTTCATTTGAAGGCATTGGAATGGTTCTGCCCCTGGAAAAC
AAAATGAAGGATCCTCGGAAGTTCCCACTCATCCTGTACCTGGGCATGGTCATCGTCACC
ATCCTCTACATCAGCCTGGGGTGTCTGGGGTACCTGCAATTTGGAGCTAATATCCAAGGC
AGCATAACCCTCAACCTGCCCAACTGCTGGTTGTACCAGTCAGTTAAGCTGCTGTACTCC
ATCGGGATCTTTTTCACCTACGCACTCCAGTTCTACGTCCCGGCTGAGATCATCATCCCC
TTCTTTGTGTCCCGAGCGCCCGAGCACTGTGAGTTAGTGGTGGACCTGTTTGTGCGCACA
GTGCTGGTCTGCCTGACATGA
GenBank Gene IDAF516142
GeneCard IDNot Available
GenAtlas IDSLC36A1
HGNC IDHGNC:18761
Chromosome Location5
Locus5q33.1
References
  1. Boll M, Foltz M, Rubio-Aliaga I, Daniel H: A cluster of proton/amino acid transporter genes in the human and mouse genomes. Genomics. 2003 Jul;82(1):47-56. 12809675
  2. Chen Z, Fei YJ, Anderson CM, Wake KA, Miyauchi S, Huang W, Thwaites DT, Ganapathy V: Structure, function and immunolocalization of a proton-coupled amino acid transporter (hPAT1) in the human intestinal cell line Caco-2. J Physiol. 2003 Jan 15;546(Pt 2):349-61. 12527723
  3. Bermingham JR Jr, Pennington J: Organization and expression of the SLC36 cluster of amino acid transporter genes. Mamm Genome. 2004 Feb;15(2):114-25. 15058382
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  8. Schroder B, Wrocklage C, Pan C, Jager R, Kosters B, Schafer H, Elsasser HP, Mann M, Hasilik A: Integral and associated lysosomal membrane proteins. Traffic. 2007 Dec;8(12):1676-86. Epub 2007 Sep 26. 17897319
  9. Dorn M, Weiwad M, Markwardt F, Laug L, Rudolph R, Brandsch M, Bosse-Doenecke E: Identification of a disulfide bridge essential for transport function of the human proton-coupled amino acid transporter hPAT1. J Biol Chem. 2009 Aug 14;284(33):22123-32. doi: 10.1074/jbc.M109.023713. Epub 2009 Jun 23. 19549785