You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAldehyde dehydrogenase family 16 member A1
SynonymsNot Available
Gene NameALDH16A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008835|Aldehyde dehydrogenase family 16 member A1
MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQ
DPITGENLASCLQAQAEDVAAAVEAARMAFKGWSAHPGVVRAQHLTRLAEVIQKHQRLLW
TLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVALVPPASPAPLLLAQLAGELGPFPGILNVLSGPASLVPILASQ
PGIRKVAFCGAPEEGRALRRSLAGECAELGLALGTESLLLLTDTADVDSAVEGVVDAAWS
DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREA
QSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEVPWPVVVASPFRTAKEALLVAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDG
LYEYLRPSGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPG
ARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE
RRKSTLASRLERQGAELKAAEAEVELSARRLRAWGARVQAQGHTLQVAGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLALEVCQDMATVFPAGLAN
VVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWASRGCPRAWDQEAE
GAGPELGLRVARTKALWLPMGD
Number of residues802
Molecular Weight85126.605
Theoretical pINot Available
GO Classification
Functions
  • aldehyde dehydrogenase (NAD) activity
Components
  • membrane
  • extracellular exosome
General FunctionAldehyde dehydrogenase (nad) activity
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8IZ83
UniProtKB Entry NameA16A1_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0013444|Aldehyde dehydrogenase family 16 member A1 (ALDH16A1)
ATGGCTGCGACGCGTGCAGGGCCCCGCGCCCGCGAGATCTTCACCTCGCTGGAGTACGGA
CCGGTGCCGGAGAGCCACGCATGCGCACTGGCCTGGCTGGACACCCAGGACCGGTGCTTG
GGCCACTATGTGAATGGGAAGTGGTTAAAGCCTGAACACAGAAATTCAGTGCCTTGCCAG
GATCCCATCACAGGAGAGAACTTGGCCAGTTGCCTGCAGGCACAGGCCGAGGATGTGGCT
GCAGCCGTGGAGGCAGCCAGGATGGCATTTAAGGGCTGGAGTGCGCACCCCGGCGTCGTC
CGGGCCCAGCACCTGACCAGGCTGGCCGAGGTGATCCAGAAGCACCAGCGGCTGCTGTGG
ACCCTGGAATCCCTGGTGACTGGGCGGGCTGTTCGAGAGGTTCGAGACGGGGACGTCCAG
CTGGCCCAGCAGCTGCTCCACTACCATGCAATCCAGGCATCCACCCAGGAGGAGGCACTG
GCAGGCTGGGAGCCCATGGGAGTAATTGGCCTCATCCTGCCACCCACATTCTCCTTCCTT
GAGATGATGTGGAGGATTTGCCCTGCCCTGGCTGTGGGCTGCACCGTGGTGGCCCTCGTG
CCCCCGGCCTCCCCGGCGCCCCTCCTCCTGGCCCAGCTGGCGGGGGAGCTGGGCCCCTTC
CCGGGAATCCTGAATGTCCTCAGTGGCCCTGCGTCCCTGGTGCCCATCCTGGCCTCCCAG
CCTGGAATCCGGAAGGTGGCCTTCTGCGGAGCCCCGGAGGGTGGCCTCAGGCTCCTCATC
CAGGAGTCTGTGTGGGATGAAGCCATGAGACGGCTGCAGGAGCGGATGGGGCGGCTTCGG
AGTGGCCGAGGGCTGGATGGGGCCGTGGACATGGGGGCCCGGGGGGCTGCCGCATGTGAC
CTGGTCCAGCGCTTTGTGCGTGAGGCCCAGAGCCAGGGTGCACAGGTGTTCCAGGCTGGT
GATGTGCCTTCGGAACGCCCATTCTATCCCCCAACCTTGGTCTCCAACCTGCCCCCAGCC
TCCCCATGTGCCCAGGTGGAGGTGCCGTGGCCTGTGGTCGTGGCCTCCCCCTTCCGCACA
GCCAAGGAGGCACTGTTGGTGGCCAACGGGACGCCCCGCGGGGGCAGCGCCAGTGTGTGG
AGCGAGAGGCTGGGGCAGGCGCTGGAGCTGGGCTATGGGCTCCAGGTGGGCACTGTCTGG
ATCAACGCCCACGGCCTCAGAGACCCTTCGGTGCCCACAGGCGGCTGCAAGGAGAGTGGG
TGTTCCTGGCACGGGGGCCCAGACGGGCTGTATGAGTATCTGCGGCCCTCAGGGACCCCT
GCCCGGCTGTCCTGCCTCTCCAAGAACCTGAACTATGACACCTTTGGCCTCGCTGTTCCC
TCAACCCTGCCGGCTGGGCCTGAAATAGGGCCCAGCCCAGCACCCCCCTATGGGCTCTTC
GTTGGGGGCCGTTTCCAGGCTCCTGGGGCCCGAAGCTCCAGGCCCATCCGGGATTCGTCT
GGCAACCTCCATGGCTACGTGGCTGAGGGTGGAGCCAAGGACATCCGAGGTGCTGTGGAG
GCCGCTCACCAGGCTTTCCCTGGCTGGGCGGGCCAGTCCCCAGGAGCCCGGGCAGCCCTG
CTGTGGGCCCTGGCGGCTGCACTGGAGCGCCGGAAGTCTACCCTGGCCTCGAGGCTGGAG
AGGCAGGGAGCGGAGCTCAAGGCTGCGGAGGCGGAGGTGGAGCTGAGCGCAAGACGACTT
CGGGCGTGGGGGGCCCGGGTGCAGGCCCAAGGCCACACCCTGCAGGTAGCCGGGCTGAGA
GGCCCTGTGCTGCGCCTGCGGGAGCCGCTGGGTGTGCTGGCTGTGGTGTGTCCGGACGAG
TGGCCCCTGCTTGCCTTCGTGTCCCTGCTGGCTCCCGCCCTGGCCTACGGCAACACTGTG
GTCATGGTGCCCAGTGCGGCCTGTCCTCTGCTGGCCCTGGAGGTCTGCCAGGACATGGCC
ACCGTGTTCCCAGCAGGCCTGGCCAACGTGGTGACAGGAGACCGGGACCATCTGACCCGC
TGCCTGGCCTTGCACCAAGACGTCCAGGCCATGTGGTATTTCGGATCAGCCCAGGGTTCC
CAGTTTGTCGAGTGGGCCTCGGCAGGAAACCTCAAACCGGTGTGGGCGAGCAGGGGCTGC
CCGCGGGCCTGGGACCAGGAGGCCGAGGGGGCAGGCCCAGAGCTGGGGCTGCGAGTGGCG
CGGACCAAGGCCCTGTGGCTGCCTATGGGGGACTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:28114
Chromosome Location19
LocusNot Available
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Hanna MC, Blackstone C: Interaction of the SPG21 protein ACP33/maspardin with the aldehyde dehydrogenase ALDH16A1. Neurogenetics. 2009 Jul;10(3):217-28. doi: 10.1007/s10048-009-0172-6. Epub 2009 Jan 31. 19184135
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  7. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712