You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHistone H1oo
Synonyms
  • H1OO
  • Oocyte-specific histone H1
  • Oocyte-specific linker histone H1
  • OSH1
Gene NameH1FOO
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008902|Histone H1oo
MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVL
EALQAGEQRRGTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARG
ATGSFKLVPKHKKKIQPRKMAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRP
AKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKA
KGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAA
APAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
Number of residues346
Molecular Weight35813.185
Theoretical pINot Available
GO Classification
Functions
  • nucleosomal DNA binding
Processes
  • meiotic cell cycle
  • nucleosome assembly
  • nucleosome positioning
  • negative regulation of stem cell differentiation
  • regulation of DNA methylation
Components
  • nucleosome
  • female germ cell nucleus
  • cytoplasm
  • nucleus
  • extracellular exosome
General FunctionNucleosomal dna binding
Specific FunctionMay play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8IZA3
UniProtKB Entry NameH1FOO_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013487|Histone H1oo (H1FOO)
ATGGCCCCCGCGACGGCTCCCAGGAGAGCGGGTGAGGCCAAGGGGAAGGGCCCCAAGAAA
CCAAGTGAGGCCAAGGAGGACCCTCCCAACGTGGGCAAGGTGAAAAAGGCAGCCAAGAGG
CCAGCAAAGGTGCAGAAGCCTCCTCCCAAGCCAGGCGCAGCCACAGAGAAGGCTCGCAAG
CAAGGCGGCGCGGCCAAGGACACCAGGGCACAGTCGGGAGAGGCTAGGAAGGTGCCCCCC
AAGCCAGACAAGGCCATGCGGGCACCTTCCAGTGCTGGTGGGCTCAGCAGGAAGGCAAAG
GCCAAAGGCAGCAGGAGCAGCCAAGGAGATGCTGAGGCCTACAGGAAAACCAAAGCTGAG
AGTAAGAGTTCAAAACCCACGGCCAGCAAGGTCAAGAATGGTGCTGCTTCCCCGACCAAA
AAGAAGGTGGTGGCCAAGGCCAAGGCCCCTAAAGCTGGGCAGGGGCCAAACACCAAGGCT
GCTGCTCCTGCTAAGGGCAGTGGGTCCAAGGTGGTACCTGCACATTTGTCCAGGAAGACA
GAGGCCCCCAAGGGCCCTAGAAAGGCTGGGCTGCCCATCAAGGCCTCATCATCCAAAGTG
TCCAGCCAGAGGGCTGAAGCTTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:18463
Chromosome Location3
LocusNot Available
References
  1. Tanaka Y, Kato S, Tanaka M, Kuji N, Yoshimura Y: Structure and expression of the human oocyte-specific histone H1 gene elucidated by direct RT-nested PCR of a single oocyte. Biochem Biophys Res Commun. 2003 May 2;304(2):351-7. 12711322
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334