You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGamma-aminobutyric acid receptor subunit gamma-1
Synonyms
  • GABA(A) receptor subunit gamma-1
Gene NameGABRG1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012496|Gamma-aminobutyric acid receptor subunit gamma-1
MGPLKAFLFSPFLLRSQSRGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEITHTISGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
QKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFE
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
Number of residues465
Molecular Weight53594.49
Theoretical pI8.23
GO Classification
Functions
  • GABA-A receptor activity
  • inhibitory extracellular ligand-gated ion channel activity
  • chloride channel activity
Processes
  • gamma-aminobutyric acid signaling pathway
  • synaptic transmission
  • chloride transmembrane transport
  • regulation of membrane potential
  • neurological system process
  • response to drug
Components
  • GABA-A receptor complex
  • cell junction
  • integral component of plasma membrane
  • synapse
  • neuron projection
  • postsynaptic membrane
  • chloride channel complex
General FunctionInhibitory extracellular ligand-gated ion channel activity
Specific FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions273-294 299-320 332-354 445-465
GenBank Protein ID193783776
UniProtKB IDQ8N1C3
UniProtKB Entry NameGBRG1_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0012497|Gamma-aminobutyric acid receptor subunit gamma-1 (GABRG1)
ATGGGTCCTTTGAAAGCTTTTCTCTTCTCCCCTTTTCTTCTGCGGAGTCAAAGTAGAGGG
GTGAGGTTGGTCTTCTTGTTACTGACCCTGCATTTGGGAAACTGTGTTGATAAGGCAGAT
GATGAAGATGATGAGGATTTAACGGTGAACAAAACCTGGGTCTTGGCCCCAAAAATTCAT
GAAGGAGATATCACACAAATTCTGAATTCATTGCTTCAAGGCTATGACAATAAACTTCGT
CCAGATATAGGAGTGAGGCCCACAGTAATTGAAACTGATGTTTATGTAAACAGCATTGGA
CCAGTTGATCCAATTAATATGGAATATACAATAGATATAATTTTTGCCCAAACCTGGTTT
GACAGTCGTTTAAAATTCAATAGTACCATGAAAGTGCTTATGCTTAACAGTAATATGGTT
GGAAAAATTTGGATTCCTGACACTTTCTTCAGAAACTCAAGAAAATCTGATGCTCACTGG
ATAACAACTCCTAATCGTCTGCTTCGAATTTGGAATGATGGACGAGTTCTGTATACTCTA
AGATTGACAATTAATGCAGAATGTTATCTTCAGCTTCATAACTTTCCCATGGATGAACAT
TCCTGTCCACTGGAATTTTCAAGCTATGGATACCCTAAAAATGAAATTGAGTATAAGTGG
AAAAAGCCCTCCGTAGAAGTGGCTGATCCTAAATACTGGAGATTATATCAGTTTGCATTT
GTAGGGTTACGGAACTCAACTGAAATCACTCACACGATCTCTGGGGATTATGTTATCATG
ACAATTTTTTTTGACCTGAGCAGAAGAATGGGATATTTCACTATTCAGACCTACATTCCA
TGCATTCTGACAGTTGTTCTTTCTTGGGTGTCTTTTTGGATCAATAAAGATGCAGTGCCT
GCAAGAACATCGTTGGGTATCACTACAGTTCTGACTATGACAACCCTGAGTACAATTGCC
AGGAAGTCTTTACCTAAGGTTTCTTATGTGACTGCGATGGATCTCTTTGTTTCTGTTTGT
TTCATTTTTGTTTTTGCAGCCTTGATGGAATATGGAACCTTGCATTATTTTACCAGCAAC
CAAAAAGGAAAGACTGCTACTAAAGACAGAAAGCTAAAAAATAAAGCCTCGATGACTCCT
GGTCTCCATCCTGGATCCACTCTGATTCCAATGAATAATATTTCTGTGCCGCAAGAAGAT
GATTATGGGTATCAGTGTTTGGAGGGCAAAGATTGTGCCAGCTTCTTCTGTTGCTTTGAA
GACTGCAGAACAGGATCTTGGAGGGAAGGAAGGATACACATACGCATTGCCAAAATTGAC
TCTTATTCTAGAATATTTTTCCCAACCGCTTTTGCCCTGTTCAACTTGGTTTATTGGGTT
GGCTATCTTTACTTATAA
GenBank Gene IDAK122845
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4086
Chromosome Location4
Locus4p12
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334