You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAquaporin-11
Synonyms
  • AQP-11
  • AQPX1
Gene NameAQP11
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013400|Aquaporin-11
MSPLLGLRSELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCC
THELQLLSEQHPAHPTWTLTLVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVR
LLAQLVSALCSRYCTSALWSLGLTQYHVSERSFACKNPIRVDLLKAVITEAVCSFLFHSA
LLHFQEVRTKLRIHLLAALITFLVYAGGSLTGAVFNPALALSLHFMCFDEAFPQFFIVYW
LAPSLGILLMILMFSFFLPWLHNNHTINKKE
Number of residues271
Molecular Weight30202.59
Theoretical pINot Available
GO Classification
Functions
  • transporter activity
Processes
  • transmembrane transport
  • water transport
  • protein homooligomerization
  • endosomal lumen acidification
  • proximal tubule development
Components
  • integral component of membrane
  • cytosol
  • dendrite
  • endoplasmic reticulum
  • plasma membrane
  • cell surface
General FunctionTransporter activity
Specific FunctionAquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Pfam Domain Function
Transmembrane Regions15-35 42-62 75-95 164-184 195-215 235-255
GenBank Protein IDNot Available
UniProtKB IDQ8NBQ7
UniProtKB Entry NameAQP11_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013401|Aquaporin-11 (AQP11)
ATGTCGCCGCTGCTGGGGCTCCGGTCCGAGCTGCAGGACACCTGCACCTCGCTGGGACTG
ATGCTGTCGGTGGTGCTGCTCATGGGGCTGGCCCGCGTAGTCGCCCGGCAGCAGCTGCAC
AGGCCGGTGGCCCACGCCTTCGTCCTGGAGTTTCTAGCCACCTTCCAGCTCTGCTGCTGC
ACCCACGAGCTGCAACTGCTGAGCGAACAGCACCCCGCGCACCCCACCTGGACGCTGACG
CTCGTCTACTTCTTCTCGCTTGTGCATGGCCTGACTCTGGTGGGCACGTCCAGCAACCCG
TGCGGCGTGATGATGCAGATGATGCTGGGGGGCATGTCCCCCGAGACGGGTGCGGTGAGG
CTATTGGCTCAGCTGGTTAGTGCCCTGTGCAGCAGGTACTGCACAAGCGCCTTGTGGAGC
TTGGGTCTGACCCAGTATCACGTCAGCGAGAGGAGCTTCGCTTGCAAGAATCCCATCCGA
GTCGACTTGCTCAAAGCGGTCATCACAGAGGCCGTCTGCTCCTTTCTCTTCCACAGCGCT
CTGCTGCACTTCCAGGAAGTCCGAACCAAGCTTCGTATCCACCTGCTGGCTGCACTCATC
ACCTTTTTGGTCTATGCAGGAGGAAGTCTAACAGGAGCTGTATTTAATCCAGCTTTGGCA
CTTTCGCTACATTTCATGTGTTTTGATGAAGCATTCCCTCAGTTTTTTATAGTATACTGG
CTGGCTCCTTCTTTAGGTATATTGTTGATGATTTTGATGTTCAGCTTTTTCCTTCCATGG
CTGCATAACAACCATACAATTAATAAAAAGGAATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:19940
Chromosome Location11
LocusNot Available
References
  1. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. 16303743
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334