You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMethylcytosine dioxygenase TET1
Synonyms
  • 1.14.11.n2
  • CXXC-type zinc finger protein 6
  • CXXC6
  • KIAA1676
  • LCX
  • Leukemia-associated protein with a CXXC domain
  • Ten-eleven translocation 1 gene protein
Gene NameTET1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0038056|Methylcytosine dioxygenase TET1
MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPVRSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPL
VVAKSKKVPLSKGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSL
LKGKSQETTQFWSQRVEDSKINIPTHSGPAAEILPGPLEGTRCGEGLFSEETLNDTSGSP
KMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESLKLSDSYLDPIKSEHDCYPTS
SLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFEATANQQEVSD
TTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSS
SNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSK
SDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQK
TNCGECTYCKNRKNSHQICKKRKCEELKKKPSVVVPLEVIKENKRPQREKKPKVLKADFD
NKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNEDSMTGIEVEKWTQNKKSQLTD
HVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAETNVSFKKFNIE
EFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQL
SEAPSENSSPSKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLE
KQSSCNTVVFNGQTTTLSNSHINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKS
IAQGIITLDNCSNDLHQLPPRNNEVEYCNQLLDSSKKLDSDDLSCQDATHTQIEEDVATQ
LTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEKGTIQQKPPSSVHNNHGSSLT
KQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIWIASKFQNFGQ
FCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIR
FQQVVKEQLMHQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSF
GTSEFSTVDSAQKNFNDYAMNFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHL
GAGPSVAAVREIMENRYGQKGNAIRIEIVVYTGKEGKSSHGCPIAKWVLRRSSDEEKVLC
LVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTENLKSYNGHPTDRRCTLNENRT
CTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEKNLEDNLQSLA
TRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPR
RKKRTCFTQPVPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPT
LGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPA
PLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPGISQLGEVAPLPTLSAPVMEP
LINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEEDEQHSEADEPPSDEPLSDDPL
SPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHATTPVEHPNRNH
PTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
Number of residues2136
Molecular Weight235306.965
Theoretical pINot Available
GO Classification
Functions
  • iron ion binding
  • zinc ion binding
  • structure-specific DNA binding
  • methylcytosine dioxygenase activity
Processes
  • negative regulation of methylation-dependent chromatin silencing
  • oxidative DNA demethylation
  • gene expression
  • positive regulation of transcription from RNA polymerase II promoter
  • transcription, DNA-templated
  • stem cell population maintenance
  • protein O-linked glycosylation
  • chromatin modification
  • regulation of gene expression, epigenetic
  • regulation of genetic imprinting
  • DNA demethylation
  • regulation of DNA methylation
  • inner cell mass cell differentiation
Components
  • nucleus
General FunctionZinc ion binding
Specific FunctionDioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, plays a more general role in chromatin regulation. Preferentially binds to CpG-rich sequences at promoters of both transcriptionally active and Polycomb-repressed genes. Involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT. Also involved in transcription repression of a subset of genes through recruitment of transcriptional repressors to promoters. Involved in the balance between pluripotency and lineage commitment of cells it plays a role in embryonic stem cells maintenance and inner cell mass cell specification.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8NFU7
UniProtKB Entry NameTET1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013961|Methylcytosine dioxygenase TET1 (TET1)
ATGTCTCGATCCCGCCATGCAAGGCCTTCCAGATTAGTCAGGAAGGAAGATGTAAACAAA
AAAAAGAAAAACAGCCAACTACGAAAGACAACCAAGGGAGCCAACAAAAATGTGGCATCA
GTCAAGACTTTAAGCCCTGGAAAATTAAAGCAATTAATTCAAGAAAGAGATGTTAAGAAA
AAAACAGAACCTAAACCACCCGTGCCAGTCAGAAGCCTTCTGACAAGAGCTGGAGCAGCA
CGCATGAATTTGGATAGGACTGAGGTTCTTTTTCAGAACCCAGAGTCCTTAACCTGCAAT
GGGTTTACAATGGCGCTACGAAGCACCTCTCTTAGCAGGCGACTCTCCCAACCCCCACTG
GTCGTAGCCAAATCCAAAAAGGTTCCACTTTCTAAGGGTTTAGAAAAGCAACATGATTGT
GATTATAAGATACTCCCTGCTTTGGGAGTAAAGCACTCAGAAAATGATTCGGTTCCAATG
CAAGACACCCAAGTCCTTCCTGATATAGAGACTCTAATTGGTGTACAAAATCCCTCTTTA
CTTAAAGGTAAGAGCCAAGAGACAACTCAGTTTTGGTCCCAAAGAGTTGAGGATTCCAAG
ATCAATATCCCTACCCACAGTGGCCCTGCAGCTGAGATCCTTCCTGGGCCACTGGAAGGG
ACACGCTGTGGTGAAGGACTATTCTCTGAAGAGACATTGAATGATACCAGTGGTTCCCCA
AAAATGTTTGCTCAGGACACAGTGTGTGCTCCTTTTCCCCAAAGAGCAACCCCCAAAGTT
ACCTCTCAAGGAAACCCCAGCATTCAGTTAGAAGAGTTGGGTTCACGAGTAGAATCTCTT
AAGTTATCTGATTCTTACCTGGATCCCATTAAAAGTGAACATGATTGCTACCCCACCTCC
AGTCTTAATAAGGTTATACCTGACTTGAACCTTAGAAACTGCTTGGCTCTTGGTGGGTCT
ACGTCTCCTACCTCTGTAATAAAATTCCTCTTGGCAGGCTCAAAACAAGCGACCCTTGGT
GCTAAACCAGATCATCAAGAGGCCTTCGAAGCTACTGCAAATCAACAGGAAGTTTCTGAT
ACCACCTCTTTCCTAGGACAGGCCTTTGGTGCTATCCCACATCAATGGGAACTTCCTGGT
GCTGACCCAGTTCATGGTGAGGCCCTGGGTGAGACCCCAGATCTACCAGAGATTCCTGGT
GCTATTCCAGTCCAAGGAGAGGTCTTTGGTACTATTTTAGACCAACAAGAAACTCTTGGT
ATGAGTGGGAGTGTTGTCCCAGACTTGCCTGTCTTCCTTCCTGTTCCTCCAAATCCAATT
GCTACCTTTAATGCTCCTTCCAAATGGCCTGAGCCCCAAAGCACTGTCTCATATGGACTT
GCAGTCCAGGGTGCTATACAGATTTTGCCTTTGGGCTCAGGACACACTCCTCAATCATCA
TCAAACTCAGAGAAAAATTCATTACCTCCAGTAATGGCTATAAGCAATGTAGAAAATGAG
AAGCAGGTTCATATAAGCTTCCTGCCAGCTAACACTCAGGGGTTCCCATTAGCCCCTGAG
AGAGGACTCTTCCATGCTTCACTGGGTATAGCCCAACTCTCTCAGGCTGGTCCTAGCAAA
TCAGACAGAGGGAGCTCCCAGGTCAGTGTAACCAGCACAGTTCATGTTGTCAACACCACA
GTGGTGACTATGCCAGTGCCAATGGTCAGTACCTCCTCTTCTTCCTATACCACTTTGCTA
CCGACTTTGGAAAAGAAGAAAAGAAAGCGATGTGGGGTCTGTGAACCCTGCCAGCAGAAG
ACCAACTGTGGTGAATGCACTTACTGCAAGAACAGAAAGAACAGCCATCAGATCTGTAAG
AAAAGAAAATGTGAGGAGCTGAAAAAGAAACCATCTGTTGTTGTGCCTCTGGAGGTTATA
AAGGAAAACAAGAGGCCCCAGAGGGAAAAGAAGCCCAAAGTTTTAAAGGCAGATTTTGAC
AACAAACCAGTAAATGGCCCCAAGTCAGAATCCATGGACTACAGTAGATGTGGTCATGGG
GAAGAACAAAAATTGGAATTGAACCCACATACTGTTGAAAATGTAACTAAAAATGAAGAC
AGCATGACAGGCATCGAGGTGGAGAAGTGGACACAAAACAAGAAATCACAGTTAACTGAT
CACGTGAAAGGAGATTTTAGTGCTAATGTCCCAGAAGCTGAAAAATCGAAAAACTCTGAA
GTTGACAAGAAACGAACCAAATCTCCAAAATTGTTTGTACAAACCGTAAGAAATGGCATT
AAACATGTACACTGTTTACCAGCTGAAACAAATGTTTCATTTAAAAAATTCAATATTGAA
GAATTCGGCAAGACATTGGAAAACAATTCTTATAAATTCCTAAAAGACACTGCAAACCAT
AAAAACGCTATGAGCTCTGTTGCTACTGATATGAGTTGTGATCATCTCAAGGGGAGAAGT
AACGTTTTAGTATTCCAGCAGCCTGGCTTTAACTGCAGTTCCATTCCACATTCTTCACAC
TCCATCATAAATCATCATGCTAGTATACACAATGAAGGTGATCAACCAAAAACTCCTGAG
AATATACCAAGTAAAGAACCAAAAGATGGATCTCCCGTTCAACCAAGTCTCTTATCGTTA
ATGAAAGATAGGAGATTAACATTGGAGCAAGTGGTAGCCATAGAGGCCCTGACTCAACTC
TCAGAAGCCCCATCAGAGAATTCCTCCCCATCAAAGTCAGAGAAGGATGAGGAATCAGAG
CAGAGAACAGCCAGTTTGCTTAATAGCTGCAAAGCTATCCTCTACACTGTAAGAAAAGAC
CTCCAAGACCCAAACTTACAGGGAGAGCCACCAAAACTTAATCACTGTCCATCTTTGGAA
AAACAAAGTTCATGCAACACGGTGGTTTTCAATGGGCAAACTACTACCCTTTCCAACTCA
CATATCAACTCAGCTACTAACCAAGCATCCACAAAGTCACATGAATATTCAAAAGTCACA
AATTCATTATCTCTTTTTATACCAAAATCAAATTCATCCAAGATTGACACCAATAAAAGT
ATTGCTCAAGGGATAATTACTCTTGACAATTGTTCCAATGATTTGCATCAGTTGCCACCA
AGAAATAATGAAGTGGAGTATTGCAACCAGTTACTGGACAGCAGCAAAAAATTGGACTCA
GATGATCTATCATGTCAGGATGCAACCCATACCCAAATTGAGGAAGATGTTGCAACACAG
TTGACACAACTTGCTTCGATAATTAAGATCAATTATATAAAACCAGAGGACAAAAAAGTT
GAAAGTACACCAACAAGCCTTGTCACATGTAATGTACAGCAAAAATACAATCAGGAGAAG
GGCACAATACAACAGAAACCACCTTCAAGTGTACACAATAATCATGGTTCATCATTAACA
AAACAAAAGAACCCAACCCAGAAAAAGACAAAATCCACCCCATCAAGAGATCGGCGGAAA
AAGAAGCCCACAGTTGTAAGTTATCAAGAAAATGATCGGCAGAAGTGGGAAAAGTTGTCC
TATATGTATGGCACAATATGCGACATTTGGATAGCATCGAAATTTCAAAATTTTGGGCAA
TTTTGTCCACATGATTTTCCTACTGTATTTGGGAAAATTTCTTCCTCGACCAAAATATGG
AAACCACTGGCTCAAACGAGGTCCATTATGCAACCCAAAACAGTATTTCCACCACTCACT
CAGATAAAATTACAGAGATATCCTGAATCAGCAGAGGAAAAGGTGAAGGTTGAACCATTG
GATTCACTCAGCTTATTTCATCTTAAAACGGAATCCAACGGGAAGGCATTCACTGATAAA
GCTTATAATTCTCAGGTACAGTTAACGGTGAATGCCAATCAGAAAGCCCATCCTTTGACC
CAGCCCTCCTCTCCACCTAACCAGTGTGCTAACGTGATGGCAGGCGATGACCAAATACGG
TTTCAGCAGGTTGTTAAGGAGCAACTCATGCATCAGAGACTGCCAACATTGCCTGGTATC
TCTCATGAAACACCCTTACCGGAGTCAGCACTAACTCTCAGGAATGTAAATGTAGTGTGT
TCAGGTGGAATTACAGTGGTTTCTACCAAAAGTGAAGAGGAAGTCTGTTCATCCAGTTTT
GGAACATCAGAATTTTCCACAGTGGACAGTGCACAGAAAAATTTTAATGATTATGCCATG
AACTTCTTTACTAACCCTACAAAAAACCTAGTGTCTATAACTAAAGATTCTGAACTGCCC
ACCTGCAGCTGTCTTGATCGAGTTATACAAAAAGACAAAGGCCCATATTATACACACCTT
GGGGCAGGACCAAGTGTTGCTGCTGTCAGGGAAATCATGGAGAATAGGTATGGTCAAAAA
GGAAACGCAATAAGGATAGAAATAGTAGTGTACACCGGTAAAGAAGGGAAAAGCTCTCAT
GGGTGTCCAATTGCTAAGTGGGTTTTAAGAAGAAGCAGTGATGAAGAAAAAGTTCTTTGT
TTGGTCCGGCAGCGTACAGGCCACCACTGTCCAACTGCTGTGATGGTGGTGCTCATCATG
GTGTGGGATGGCATCCCTCTTCCAATGGCCGACCGGCTATACACAGAGCTCACAGAGAAT
CTAAAGTCATACAATGGGCACCCTACCGACAGAAGATGCACCCTCAATGAAAATCGTACC
TGTACATGTCAAGGAATTGATCCAGAGACTTGTGGAGCTTCATTCTCTTTTGGCTGTTCA
TGGAGTATGTACTTTAATGGCTGTAAGTTTGGTAGAAGCCCAAGCCCCAGAAGATTTAGA
ATTGATCCAAGCTCTCCCTTACATGAAAAAAACCTTGAAGATAACTTACAGAGTTTGGCT
ACACGATTAGCTCCAATTTATAAGCAGTATGCTCCAGTAGCTTACCAAAATCAGGTGGAA
TATGAAAATGTTGCCCGAGAATGTCGGCTTGGCAGCAAGGAAGGTCGTCCCTTCTCTGGG
GTCACTGCTTGCCTGGACTTCTGTGCTCATCCCCACAGGGACATTCACAACATGAATAAT
GGAAGCACTGTGGTTTGTACCTTAACTCGAGAAGATAACCGCTCTTTGGGTGTTATTCCT
CAAGATGAGCAGCTCCATGTGCTACCTCTTTATAAGCTTTCAGACACAGATGAGTTTGGC
TCCAAGGAAGGAATGGAAGCCAAGATCAAATCTGGGGCCATCGAGGTCCTGGCACCCCGC
CGCAAAAAAAGAACGTGTTTCACTCAGCCTGTTCCCCGTTCTGGAAAGAAGAGGGCTGCG
ATGATGACAGAGGTTCTTGCACATAAGATAAGGGCAGTGGAAAAGAAACCTATTCCCCGA
ATCAAGCGGAAGAATAACTCAACAACAACAAACAACAGTAAGCCTTCGTCACTGCCAACC
TTAGGGAGTAACACTGAGACCGTGCAACCTGAAGTAAAAAGTGAAACCGAACCCCATTTT
ATCTTAAAAAGTTCAGACAACACTAAAACTTATTCGCTGATGCCATCCGCTCCTCACCCA
GTGAAAGAGGCATCTCCAGGCTTCTCCTGGTCCCCGAAGACTGCTTCAGCCACACCAGCT
CCACTGAAGAATGACGCAACAGCCTCATGCGGGTTTTCAGAAAGAAGCAGCACTCCCCAC
TGTACGATGCCTTCGGGAAGACTCAGTGGTGCCAATGCAGCTGCTGCTGATGGCCCTGGC
ATTTCACAGCTTGGCGAAGTGGCTCCTCTCCCCACCCTGTCTGCTCCTGTGATGGAGCCC
CTCATTAATTCTGAGCCTTCCACTGGTGTGACTGAGCCGCTAACGCCTCATCAGCCAAAC
CACCAGCCCTCCTTCCTCACCTCTCCTCAAGACCTTGCCTCTTCTCCAATGGAAGAAGAT
GAGCAGCATTCTGAAGCAGATGAGCCTCCATCAGACGAACCCCTATCTGATGACCCCCTG
TCACCTGCTGAGGAGAAATTGCCCCACATTGATGAGTATTGGTCAGACAGTGAGCACATC
TTTTTGGATGCAAATATTGGTGGGGTGGCCATCGCACCTGCTCACGGCTCGGTTTTGATT
GAGTGTGCCCGGCGAGAGCTGCACGCTACCACTCCTGTTGAGCACCCCAACCGTAATCAT
CCAACCCGCCTCTCCCTTGTCTTTTACCAGCACAAAAACCTAAATAAGCCCCAACATGGT
TTTGAACTAAACAAGATTAAGTTTGAGGCTAAAGAAGCTAAGAATAAGAAAATGAAGGCC
TCAGAGCAAAAAGACCAGGCAGCTAATGAAGGTCCAGAACAGTCCTCTGAAGTAAATGAA
TTGAACCAAATTCCTTCTCATAAAGCATTAACATTAACCCATGACAATGTTGTCACCGTG
TCCCCTTATGCTCTCACACACGTTGCGGGGCCCTATAACCATTGGGTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29484
Chromosome Location10
LocusNot Available
References
  1. Ono R, Taki T, Taketani T, Taniwaki M, Kobayashi H, Hayashi Y: LCX, leukemia-associated protein with a CXXC domain, is fused to MLL in acute myeloid leukemia with trilineage dysplasia having t(10;11)(q22;q23). Cancer Res. 2002 Jul 15;62(14):4075-80. 12124344
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  3. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. 11214970
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Lorsbach RB, Moore J, Mathew S, Raimondi SC, Mukatira ST, Downing JR: TET1, a member of a novel protein family, is fused to MLL in acute myeloid leukemia containing the t(10;11)(q22;q23). Leukemia. 2003 Mar;17(3):637-41. 12646957
  7. Kriaucionis S, Heintz N: The nuclear DNA base 5-hydroxymethylcytosine is present in Purkinje neurons and the brain. Science. 2009 May 15;324(5929):929-30. doi: 10.1126/science.1169786. Epub 2009 Apr 16. 19372393
  8. Tahiliani M, Koh KP, Shen Y, Pastor WA, Bandukwala H, Brudno Y, Agarwal S, Iyer LM, Liu DR, Aravind L, Rao A: Conversion of 5-methylcytosine to 5-hydroxymethylcytosine in mammalian DNA by MLL partner TET1. Science. 2009 May 15;324(5929):930-5. doi: 10.1126/science.1170116. Epub 2009 Apr 16. 19372391
  9. Guo JU, Su Y, Zhong C, Ming GL, Song H: Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain. Cell. 2011 Apr 29;145(3):423-34. doi: 10.1016/j.cell.2011.03.022. Epub 2011 Apr 14. 21496894
  10. Williams K, Christensen J, Pedersen MT, Johansen JV, Cloos PA, Rappsilber J, Helin K: TET1 and hydroxymethylcytosine in transcription and DNA methylation fidelity. Nature. 2011 May 19;473(7347):343-8. doi: 10.1038/nature10066. Epub 2011 Apr 13. 21490601
  11. Ito S, Shen L, Dai Q, Wu SC, Collins LB, Swenberg JA, He C, Zhang Y: Tet proteins can convert 5-methylcytosine to 5-formylcytosine and 5-carboxylcytosine. Science. 2011 Sep 2;333(6047):1300-3. doi: 10.1126/science.1210597. Epub 2011 Jul 21. 21778364