You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMitogen-activated protein kinase 15
Synonyms
  • 2.7.11.24
  • ERK-7
  • ERK-8
  • ERK7
  • ERK8
  • Extracellular signal-regulated kinase 7
  • Extracellular signal-regulated kinase 8
  • MAP kinase 15
Gene NameMAPK15
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008773|Mitogen-activated protein kinase 15
MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV
Number of residues544
Molecular Weight59831.645
Theoretical pINot Available
GO Classification
Functions
  • SH3 domain binding
  • ATP binding
  • MAP kinase activity
Processes
  • MAPK cascade
  • protein autophosphorylation
  • positive regulation of telomerase activity
  • positive regulation of telomere capping
  • positive regulation of telomere maintenance via telomerase
Components
  • intracellular
  • extracellular region
General FunctionSh3 domain binding
Specific FunctionIn vitro, phosphorylates MBP.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8TD08
UniProtKB Entry NameMK15_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0020819|Mitogen-activated protein kinase 15 (MAPK15)
ATGTGCACCGTAGTGGACCCTCGCATTGTCCGGAGATACCTACTCAGGCGGCAGCTCGGG
CAGGGGGCCTATGGCATTGTGTGGAAGGCAGTGGACCGGAGGACTGGTGAGGTCGTGGCC
ATCAAGAAAATCTTTGATGCTTTTAGGGATAAGACAGATGCCCAGAGAACATTCCGGGAA
ATCACGCTCCTCCAGGAGTTTGGGGACCATCCCAACATCATCAGCCTCCTTGACGTGATC
CGGGCAGAGAACGACAGGGACATTTACCTGGTGTTTGAGTTTATGGACACTGACCTGAAC
GCAGTCATCCGGAAGGGCGGCCTGCTGCAGGACGTCCACGTGCGCTCCATCTTCTACCAG
CTCCTGCGGGCCACCCGGTTCCTCCACTCGGGGCACGTTGTGCACCGGGACCAGAAGCCG
TCCAATGTGCTCCTGGATGCCAACTGCACAGTGAAGCTGTGTGACTTTGGCCTGGCCCGC
TCCCTGGGCGACCTCCCCGAGGGGCCTGAGGACCAGGCCGTGACAGAGTACGTGGCCACA
CGCTGGTACCGAGCACCGGAGGTGCTGCTCTCTTCGCACCGATACACCCTTGGGGTGGAC
ATGTGGAGTCTGGGCTGTATCCTGGGGGAGATGCTGCGGGGGAGACCCCTGTTCCCCGGC
ACGTCCACCCTCCACCAGCTGGAGCTGATCCTGGAGACCATCCCACCGCCATCTGAGGAG
GACCTCCTGGCTCTCGGCTCAGGCTGCCGTGCCTCTGTGCTGCACCAGCTGGGGTCCCGG
CCACGACAGACGCTGGATGCCCTCCTACCGCCAGACACCTCCCCAGAGGCCTTGGACCTC
CTTAGGCGACTCCTGGTGTTCGCCCCGGACAAGCGGTTAAGCGCGACCCAGGCACTGCAG
CACCCCTACGTGCAGAGGTTCCACTGCCCCAGCGACGAGTGGGCACGAGAGGCAGATGTG
CGGCCCCGGGCACACGAAGGGGTCCAGCTCTCTGTGCCTGAGTACCGCAGCCGCGTCTAT
CAGATGATCCTGGAGTGTGGAGGCAGCAGCGGCACCTCGAGAGAGAAGGGCCCGGAGGGT
GTCTCCCCAAGCCAGGCACACCTGCACAAACCCAGAGCCGACCCTCAGCTGCCTTCTAGG
ACACCTGTGCAGGGTCCCAGACCCAGGCCCCAGAGCAGCCCAGGCCATGACCCTGCCGAG
CACGAGTCCCCCCGTGCAGCCAAGAACGTTCCCAGGCAGAACTCCGCTCCCCTGCTCCAA
ACTGCTCTCCTAGGGAATGGGGAAAGGCCCCCTGGGGCGAAGGAAGCGCCCCCCTTGACA
CTCTCGCTGGTGAAGCCAAGCGGGAGGGGAGCTGCGCCCTCCCTGACCTCCCAGGCTGCG
GCTCAGGTGGCCAACCAGGCCCTGATCCGGGGTGACTGGAACCGGGGCGGTGGGGTGAGG
GTGGCCAGCGTACAACAGGTCCCTCCCCGGCTTCCTCCGGAGGCCCGGCCCGGCCGGAGG
ATGTTCAGCACCTCTGCCTTGCAGGGTGCCCAGGGGGGTGCCAGGGCTTTGCTTGGAGGC
TACTCCCAAGCCTACGGGACTGTCTGCCACTCGGCACTGGGCCACCTGCCCCTGCTGGAG
GGGCACCATGTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:24667
Chromosome LocationNot Available
LocusNot Available
References
  1. Abe MK, Saelzler MP, Espinosa R 3rd, Kahle KT, Hershenson MB, Le Beau MM, Rosner MR: ERK8, a new member of the mitogen-activated protein kinase family. J Biol Chem. 2002 May 10;277(19):16733-43. Epub 2002 Mar 1. 11875070
  2. Iavarone C, Acunzo M, Carlomagno F, Catania A, Melillo RM, Carlomagno SM, Santoro M, Chiariello M: Activation of the Erk8 mitogen-activated protein (MAP) kinase by RET/PTC3, a constitutively active form of the RET proto-oncogene. J Biol Chem. 2006 Apr 14;281(15):10567-76. Epub 2006 Feb 16. 16484222
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Saelzler MP, Spackman CC, Liu Y, Martinez LC, Harris JP, Abe MK: ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5. J Biol Chem. 2006 Jun 16;281(24):16821-32. Epub 2006 Apr 18. 16624805
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195