You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent calcium channel gamma-8 subunit
Synonyms
  • CACNG6
  • Neuronal voltage-gated calcium channel gamma-8 subunit
  • TARP gamma-8
  • Transmembrane AMPAR regulatory protein gamma-8
Gene NameCACNG8
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008868|Voltage-dependent calcium channel gamma-8 subunit
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV
Number of residues425
Molecular Weight43312.44
Theoretical pINot Available
GO Classification
Functions
  • channel regulator activity
  • voltage-gated calcium channel activity
Processes
  • calcium ion transmembrane transport
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
  • calcium ion transport
  • transmission of nerve impulse
  • synaptic transmission
Components
  • endocytic vesicle membrane
  • AMPA glutamate receptor complex
  • voltage-gated calcium channel complex
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • postsynaptic density
General FunctionVoltage-gated calcium channel activity
Specific FunctionRegulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Pfam Domain Function
Transmembrane Regions19-39 129-149 158-178 208-228 318-338
GenBank Protein IDNot Available
UniProtKB IDQ8WXS5
UniProtKB Entry NameCCG8_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0017618|Voltage-dependent calcium channel gamma-8 subunit (CACNG8)
CTGGAGTCGCTGAAGCGCTGGAACGAAGAGCGGGGCCTCTGGTGCGAGAAGGGGGTGCAG
GTGCTGCTGACGACGGTGGGCGCCTTCGCCGCCTTCGGCCTCATGACCATCGCCATCAGC
ACTGACTACTGGCTCTACACGCGCGCCCTCATCTGCAACACCACCAACCTCACGGCCGGC
GGCGACGACGGGACCCCCCACCGCGGGGGCGGCGGCGCCTCGGAGAAGAAGGACCCCGGC
GGCCTCACGCACTCGGGCCTCTGGAGGATCTGCTGCCTGGAAGGGTTGAAAAGAGGCGTC
TGCGTGAAGATCAATCATTTCCCGGAGGACACGGACTACGACCACGACAGCGCGGAGTAT
CTACTCCGAGTTGTCCGGGCCTCCAGCATCTTCCCCATCCTTAGCGCCATCCTGCTGCTG
CTCGGGGGTGTGTGCGTGGCGGCCTCCCGCGTCTACAAGTCCAAGAGGAACATCATTCTG
GGCGCAGGGATCCTGTTCGTGGCAGCAGGCCTGAGCAACATCATCGGCGTGATCGTGTAC
ATCTCCGCCAACGCGGGCGAGCCGGGCCCGAAGCGGGACGAGGAGAAGAAAAACCACTAC
TCGTACGGCTGGTCCTTCTACTTCGGCGGGCTGTCGTTCATCCTGGCCGAGGTGATAGGC
GTGCTGGCCGTCAACATCTACATCGAGCGCAGCCGCGAGGCGCACTGCCAGTCTCGCTCG
GACCTGCTCAAGGCCGGCGGGGGCGCGGGCGGCAGTGGCGGGAGCGGCCCCTCGGCCATC
CTCCGTCTGCCCAGTTACCGCTTCCGCTACCGCCGCCGCTCCCGCTCTAGCTCCCGCTCC
AGCGAGCCGTCGCCGTCGCGGGACGCGTCTCCCGGCGGCCCCGGGGGCCCGGGCTTTGCC
TCCACGGACATCTCCATGTACACGCTCAGCCGCGACCCCTCCAAGGGCAGCGTGGCCGCG
GGGCTGGCGGGGGCCGGCGGCGGCGGCGGCGGCGCCGTGGGGGCGTTCGGCGGCGCGGCC
GGGGGCGCCGGGGGCGGCGGCGGAGGCGGCGGCGGGGCGGGTGCCGAGCGGGACCGCGGG
GGGGCGTCCGGCTTCCTCACGCTGCACAACGCCTTCCCCAAGGAGGCGGGCGGCGGCGTC
ACGGTCACGGTCACCGGGCCGCCCGCCCCGCCCGCGCCCGCGCCACCCGCGCCCTCTGCG
CCCGCCCCCGGGACCCTGGCCAAGGAGGCCGCCGCCTCCAACACCAACACGCTCAACAGG
AAAACCACGCCTGTGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:13628
Chromosome Location19
LocusNot Available
References
  1. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. 11738816
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  3. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. 11170751
  4. Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. 21172611
  5. Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA: Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proc Natl Acad Sci U S A. 2010 Sep 14;107(37):16315-9. doi: 10.1073/pnas.1011706107. Epub 2010 Aug 30. 20805473