You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase U
Synonyms
  • 3.1.3.48
  • FMI
  • hPTP-J
  • Pancreatic carcinoma phosphatase 2
  • PCP-2
  • PCP2
  • Protein-tyrosine phosphatase J
  • Protein-tyrosine phosphatase pi
  • Protein-tyrosine phosphatase receptor omicron
  • PTP pi
  • PTP-J
  • PTP-RO
  • PTPRO
  • R-PTP-psi
  • R-PTP-U
  • Receptor-type protein-tyrosine phosphatase psi
Gene NamePTPRU
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008993|Receptor-type tyrosine-protein phosphatase U
MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARV
FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHC
LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EGLESR
Number of residues1446
Molecular Weight162422.095
Theoretical pINot Available
GO Classification
Functions
  • beta-catenin binding
  • transmembrane receptor protein tyrosine phosphatase activity
  • protein tyrosine phosphatase activity
Processes
  • protein localization to cell surface
  • cell adhesion
  • transmembrane receptor protein tyrosine phosphatase signaling pathway
  • homotypic cell-cell adhesion
  • cell differentiation
  • negative regulation of cell proliferation
  • response to glucocorticoid
  • negative regulation of cell migration
  • protein dephosphorylation
  • organ regeneration
  • single organismal cell-cell adhesion
  • peptidyl-tyrosine dephosphorylation
  • canonical Wnt signaling pathway
Components
  • plasma membrane
  • integral component of plasma membrane
  • cell-cell junction
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionTyrosine-protein phosphatase which dephosphorylates CTNNB1. Regulates CTNNB1 function both in cell adhesion and signaling. May function in cell proliferation and migration and play a role in the maintenance of epithelial integrity. May play a role in megakaryocytopoiesis.
Pfam Domain Function
Transmembrane Regions750-770
GenBank Protein IDNot Available
UniProtKB IDQ92729
UniProtKB Entry NamePTPRU_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0013553|Receptor-type tyrosine-protein phosphatase U (PTPRU)
ATGGCCCGTGCCCAGGCGCTCGTGCTGGCACTCACCTTCCAGCTCTGCGCGCCGGAGACC
GAGACTCCGGCAGCTGGCTGCACCTTCGAGGAGGCAAGTGACCCAGCAGTGCCCTGCGAG
TACAGCCAGGCCCAGTACGATGACTTCCAGTGGGAGCAAGTGCGAATCCACCCTGGCACC
CGGGCACCTGCGGACCTGCCCCACGGCTCCTACTTGATGGTCAACACTTCCCAGCATGCC
CCAGGCCAGCGAGCCCATGTCATCTTCCAGAGCCTGAGCGAGAATGATACCCACTGTGTG
CAGTTCAGCTACTTCCTGTACAGCCGGGACGGGCACAGCCCGGGCACCCTGGGCGTCTAC
GTGCGCGTTAATGGGGGCCCCCTGGGCAGTGCTGTGTGGAATATGACTGGATCCCACGGC
CGTCAGTGGCACCAGGCTGAGCTGGCTGTCAGCACTTTCTGGCCCAATGAATATCAGGTG
CTGTTTGAGGCCCTCATCTCCCCAGACCGCAGGGGCTACATGGGCCTAGATGACATCCTG
CTTCTCAGCTACCCCTGCGCAAAGGCCCCACACTTCTCCCGCCTGGGCGACGTGGAGGTC
AACGCGGGCCAGAACGCGTCGTTCCAGTGCATGGCCGCGGGCAGAGCGGCCGAGGCCGAA
CGCTTCCTCTTGCAACGGCAGAGCGGGGCGCTGGTGCCGGCGGCGGGCGTGCGGCACATC
AGCCACCGGCGCTTCCTGGCCACTTTCCCGCTGGCTGCCGTGAGCCGCGCCGAGCAGGAC
CTGTACCGCTGTGTGTCCCAGGCCCCGCGCGGCGCGGGCGTCTCTAACTTCGCGGAGCTC
ATCGTCAAGGAGCCCCCAACTCCCATCGCGCCCCCACAGCTGCTGCGTGCTGGCCCCACC
TACCTCATCATCCAGCTCAACACCAACTCCATCATTGGCGACGGGCCGATCGTGCGCAAG
GAGATTGAGTACCGCATGGCGCGCGGGCCCTGGGCTGAGGTGCACGCCGTCAGCCTGCAG
ACCTACAAGCTGTGGCACCTCGACCCCGACACAGAGTATGAGATCAGCGTGCTGCTCACG
CGTCCCGGAGACGGCGGCACTGGCCGCCCTGGGCCACCCCTCATCAGCCGCACCAAATGC
GCAGAGCCCATGAGGGCCCCCAAAGGCCTGGCTTTTGCTGAGATCCAGGCCCGTCAGCTG
ACCCTGCAGTGGGAACCACTGGGCTACAACGTGACGCGTTGCCACACCTATACTGTGTCG
CTGTGCTATCACTACACCCTGGGCAGCAGCCACAACCAGACCATCCGAGAGTGTGTGAAG
ACAGAGCAAGGTGTCAGCCGCTACACCATCAAGAACCTGCTGCCCTATCGGAACGTTCAC
GTGAGGCTTGTCCTCACTAACCCTGAGGGGCGCAAAGAGGGCAAGGAGGTCACTTTCCAG
ACGGATGAGGATGTGCCCAGTGGGATTGCAGCCGAGTCCCTGACCTTCACTCCACTGGAG
GACATGATCTTCCTCAAGTGGGAGGAGCCCCAGGAGCCCAATGGTCTCATCACCCAGTAT
GAGATCAGCTACCAGAGCATCGAGTCATCAGACCCGGCAGTGAACGTGCCAGGCCCACGA
CGTACCATCTCCAAGCTCCGCAATGAGACCTACCATGTCTTCTCCAACCTGCACCCAGGC
ACCACCTACCTGTTCTCCGTGCGGGCCCGCACAGGCAAAGGCTTCGGCCAGGCGGCACTC
ACTGAGATAACCACTAACATCTCTGCTCCCAGCTTTGATTATGCCGACATGCCGTCACCC
CTGGGCGAGTCTGAGAACACCATCACCGTGCTGCTGAGGCCGGCACAGGGCCGCGGTGCG
CCCATCAGTGTGTACCAGGTGATTGTGGAGGAGGAGCGGGCGCGGAGGCTGCGGCGGGAG
CCAGGTGGACAGGACTGCTTCCCAGTGCCATTGACCTTCGAGGCGGCGCTGGCCCGAGGC
CTGGTGCACTACTTCGGGGCCGAACTGGCGGCCAGCAGTCTACCTGAGGCCATGCCCTTT
ACCGTGGGTGACAACCAGACCTACCGAGGCTTCTGGAACCCACCACTTGAGCCTAGGAAG
GCCTATCTCATCTACTTCCAGGCAGCAAGCCACCTGAAGGGGGAGACCCGGCTGAATTGC
ATCCGCATTGCCAGGAAAGCTGCCTGCAAGGAAAGCAAGCGGCCCCTGGAGGTGTCCCAG
AGATCGGAGGAGATGGGGCTTATCCTGGGCATCTGTGCAGGGGGGCTTGCTGTCCTCATC
CTTCTCCTGGGTGCCATCATTGTCATCATCCGCAAAGGGAAGCCGGTGAACATGACCAAG
GCCACCGTCAACTACCGCCAGGAGAAGACACACATGATGAGCGCCGTGGACCGCAGCTTC
ACAGACCAGAGCACCCTGCAGGAGGACGAGCGGCTGGGCCTGTCCTTCATGGACACCCAT
GGCTACAGCACCCGGGGAGACCAGCGCAGCGGTGGGGTCACTGAGGCCAGCAGCCTCCTG
GGGGGCTCCCCGAGGCGTCCCTGTGGCCGGAAGGGCTCCCCATACCACACGGGGCAGCTG
CACCCTGCGGTGCGTGTCGCAGACCTTCTGCAGCACATCAACCAGATGAAGACGGCCGAG
GGTTACGGCTTCAAGCAGGAGTATGAGAGCTTCTTTGAAGGCTGGGACGCCACAAAGAAG
AAAGACAAGGTCAAGGGCAGCCGGCAGGAGCCAATGCCTGCCTATGATCGGCACCGAGTG
AAACTGCACCCGATGCTGGGAGACCCCAATGCCGACTACATTAATGCCAACTACATAGAT
GGTTACCACAGGTCAAACCACTTCATAGCCACTCAAGGGCCGAAGCCTGAGATGGTCTAT
GACTTCTGGCGTATGGTGTGGCAGGAGCACTGTTCCAGCATCGTCATGATCACCAAGCTG
GTCGAGGTGAAATGCTCACGGTACTGGCCGGAGGACTCAGACACCTACGGGGACATCAAG
ATTATGCTGGTGAAGACAGAGACCCTGGCTGAGTATGTCGTGCGCACTTTTGCCCTGGAG
CGGAGAGGCTACTCTGCCCGGCACGAGGTCCGCCAGTTCCACTTCACAGCGTGGCCAGAG
CATGGCGTCCCCTACCATGCCACGGGGCTGCTGGCTTTCATCCGGCGCGTGAAGGCCTCC
ACCCCACCTGATGCCGGGCCCATTGTCATCCACTGCAGCGCGGGCACCGGCCGCACAGGT
TGCTATATCGTCCTGGATGTGATGCTGGACATGGCAGAGTGTGAGGGCGTCGTGGACATT
TACAACTGTGTGAAGACTCTCTGCTCCCGGCGTGTCAACATGATCCAGACTGAGGAGCAG
TACATCTTCATTCATGATGCAATCCTGGAGGCCTGCCTGTGTGGGGAGACCACCATCCCT
GTCAGTGAGTTCAAGGCCACCTACAAGGAGATGATCCGCATTGATCCTCAGAGTAATTCC
TCCCAGCTGCGGGAAGAGTTCCAGACGCTGAACTCGGTCACCCCGCCGCTGGACGTGGAG
GAGTGCAGCATCGCCCTGTTGCCCCGGAACCGCGACAAGAACCGCAGCATGGACGTCCTG
CCGCCCGACCGCTGCCTGCCCTTCCTCATCTCCACTGATGGGGACTCCAACAACTACATT
AATGCAGCCCTGACTGACAGCTACACACGGAGTGCGGCCTTCATCGTGACCCTGCACCCG
CTGCAGAGCACCACGCCCGACTTCTGGCGGCTGGTCTACGATTACGGGTGCACCTCCATC
GTCATGCTCAACCAGCTGAACCAGTCCAACTCCGCCTGGCCCTGCCTGCAGTACTGGCCA
GAGCCAGGCCGGCAGCAATATGGCCTCATGGAGGTGGAGTTTATGTCGGGCACAGCTGAT
GAAGACTTAGTGGCTCGAGTCTTCCGGGTGCAGAACATCTCTCGGTTGCAGGAGGGGCAC
CTGCTGGTGCGGCACTTCCAGTTCCTGCGCTGGTCTGCATACCGGGACACACCTGACTCC
AAGAAGGCCTTCTTGCACCTGCTGGCTGAGGTGGACAAGTGGCAGGCCGAGAGTGGGGAT
GGGCGCACCATCGTGCACTGCCTAAACGGGGGAGGACGCAGCGGCACCTTCTGCGCCTGC
GCCACGGTCCTGGAGATGATCCGCTGCCACAACTTGGTGGACGTTTTCTTTGCTGCCAAA
ACCCTCCGGAACTACAAACCCAACATGGTGGAGACCATGGATCAGTACCACTTTTGCTAC
GATGTGGCCCTGGAGTACTTGGAGGGGCTGGAGTCAAGATAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9683
Chromosome Location1
LocusNot Available
References
  1. Crossland S, Smith PD, Crompton MR: Molecular cloning and characterization of PTP pi, a novel receptor-like protein-tyrosine phosphatase. Biochem J. 1996 Oct 1;319 ( Pt 1):249-54. 8870675
  2. Wang H, Lian Z, Lerch MM, Chen Z, Xie W, Ullrich A: Characterization of PCP-2, a novel receptor protein tyrosine phosphatase of the MAM domain family. Oncogene. 1996 Jun 20;12(12):2555-62. 8700514
  3. Wang B, Kishihara K, Zhang D, Hara H, Nomoto K: Molecular cloning and characterization of a novel human receptor protein tyrosine phosphatase gene, hPTP-J: down-regulation of gene expression by PMA and calcium ionophore in Jurkat T lymphoma cells. Biochem Biophys Res Commun. 1997 Feb 3;231(1):77-81. 9070223
  4. Avraham S, London R, Tulloch GA, Ellis M, Fu Y, Jiang S, White RA, Painter C, Steinberger AA, Avraham H: Characterization and chromosomal localization of PTPRO, a novel receptor protein tyrosine phosphatase, expressed in hematopoietic stem cells. Gene. 1997 Dec 19;204(1-2):5-16. 9434160
  5. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Wang B, Kishihara K, Zhang D, Sakamoto T, Nomoto K: Transcriptional regulation of a receptor protein tyrosine phosphatase gene hPTP-J by PKC-mediated signaling pathways in Jurkat and Molt-4 T lymphoma cells. Biochim Biophys Acta. 1999 Jul 8;1450(3):331-40. 10395944
  8. Taniguchi Y, London R, Schinkmann K, Jiang S, Avraham H: The receptor protein tyrosine phosphatase, PTP-RO, is upregulated during megakaryocyte differentiation and Is associated with the c-Kit receptor. Blood. 1999 Jul 15;94(2):539-49. 10397721
  9. Yan HX, He YQ, Dong H, Zhang P, Zeng JZ, Cao HF, Wu MC, Wang HY: Physical and functional interaction between receptor-like protein tyrosine phosphatase PCP-2 and beta-catenin. Biochemistry. 2002 Dec 31;41(52):15854-60. 12501215
  10. Yan HX, Yang W, Zhang R, Chen L, Tang L, Zhai B, Liu SQ, Cao HF, Man XB, Wu HP, Wu MC, Wang HY: Protein-tyrosine phosphatase PCP-2 inhibits beta-catenin signaling and increases E-cadherin-dependent cell adhesion. J Biol Chem. 2006 Jun 2;281(22):15423-33. Epub 2006 Mar 30. 16574648
  11. Dong H, Yuan H, Jin W, Shen Y, Xu X, Wang H: Involvement of beta3A subunit of adaptor protein-3 in intracellular trafficking of receptor-like protein tyrosine phosphatase PCP-2. Acta Biochim Biophys Sin (Shanghai). 2007 Jul;39(7):540-6. 17622474
  12. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  13. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974