You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase N2
Synonyms
  • 3.1.3.48
  • IAR
  • ICAAR
  • Islet cell autoantigen-related protein
  • KIAA0387
  • Phogrin
  • R-PTP-N2
Gene NamePTPRN2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009004|Receptor-type tyrosine-protein phosphatase N2
MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ
Number of residues1015
Molecular Weight111270.29
Theoretical pINot Available
GO Classification
Functions
  • transmembrane receptor protein tyrosine phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • negative regulation of GTPase activity
  • neurotransmitter secretory pathway
  • insulin secretion involved in cellular response to glucose stimulus
  • protein dephosphorylation
Components
  • synaptic vesicle membrane
  • secretory granule membrane
  • transport vesicle membrane
  • receptor complex
  • cell junction
  • integral component of plasma membrane
  • endoplasmic reticulum lumen
  • terminal bouton
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionPlays a role in vesicle-mediated secretory processes. Required for normal accumulation of secretory vesicles in hippocampus, pituitary and pancreatic islets. Required for the accumulation of normal levels of insulin-containing vesicles and preventing their degradation. Plays a role in insulin secretion in response to glucose stimuli. Required for normal accumulation of the neurotransmitters norepinephrine, dopamine and serotonin in the brain. In females, but not in males, required for normal accumulation and secretion of pituitary hormones, such as luteinizing hormone (LH) and follicle-stimulating hormone (FSH).
Pfam Domain Function
Transmembrane Regions616-636
GenBank Protein IDNot Available
UniProtKB IDQ92932
UniProtKB Entry NamePTPR2_HUMAN
Cellular LocationCytoplasmic vesicle
Gene sequence
>lcl|BSEQ0013559|Receptor-type tyrosine-protein phosphatase N2 (PTPRN2)
ATGGGGCCGCCGCTCCCGCTGCTGCTGCTGCTACTGCTGCTGCTGCCGCCACGCGTCCTG
CCTGCCGCCCCTTCGTCCGTCCCCCGCGGCCGGCAGCTCCCGGGGCGTCTGGGCTGCCTG
CTCGAGGAGGGCCTCTGCGGAGCGTCCGAGGCCTGTGTGAACGGTTTCACGTGGCAGGAT
GACTATACTCAGTATGTGATGGACCAGGAACTTGCAGACCTCCCGAAAACCTACCTGAGG
CGTCCTGAAGCATCCAGCCCAGCCAGGCCCTCAAAACACAGCGTTGGCAGCGAGAGGAGG
TACAGTCGGGAGGGCGGTGCTGCCCTGGCCAACGCCCTCCGACGCCACCTGCCCTTCCTG
GAGGCCCTGTCCCAGGCCCCAGCCTCAGACGTGCTCGCCAGGACCCATACGGCGCAGGAC
AGACCCCCCGCTGAGGGTGATGACCGCTTCTCCGAGAGCATCCTGACCTATGTGGCCCAC
ACGTCTGCGCTGACCTACCCTCCCGGGTCCCGGACCCAGCTCCGCGAGGACCTCCTGCCG
CGGACCCTCGGCCAGCTCCAGCCAGATGAGCTCAGCCCTAAGGTGGACAGTGGTGTGGAC
AGACACCATCTGATGGCGGCCCTCAGTGCCTATGCTGCCCAGAGGCCCCCAGCTCCCCCC
GGGGAGGGCAGCCTGGAGCCACAGTACCTTCTGCGTGCACCCTCAAGAATGCCCAGGCCT
TTGCTGGCACCAGCCGCCCCCCAGAAGTGGCCTTCACCTCTGGGAGATTCCGAAGACCCC
TCCAGCACAGGCGATGGAGCACGGATTCATACCCTCCTGAAGGACCTGCAGAGGCAGCCG
GCTGAGGTGAGGGGCCTGAGTGGCCTGGAGCTGGACGGCATGGCTGAGCTGATGGCTGGC
CTGATGCAAGGCGTGGACCATGGAGTAGCTCGAGGCAGCCCTGGGAGAGCGGCCCTGGGA
GAGTCTGGAGAACAGGCGGATGGCCCCAAGGCCACCCTCCGTGGAGACAGCTTTCCAGAT
GACGGAGTGCAGGACGACGATGATAGACTTTACCAAGAGGTCCATCGTCTGAGTGCCACA
CTCGGGGGCCTCCTGCAGGACCACGGGTCTCGACTCTTACCTGGAGCCCTCCCCTTTGCA
AGGCCCCTCGACATGGAGAGGAAGAAGTCCGAGCACCCTGAGTCTTCCCTGTCTTCAGAA
GAGGAGACTGCCGGAGTGGAGAACGTCAAGAGCCAGACGTATTCCAAAGATCTGCTGGGG
CAGCAGCCGCATTCGGAGCCCGGGGCCGCTGCGTTTGGGGAGCTCCAAAACCAGATGCCT
GGGCCCTCGAAGGAGGAGCAGAGCCTTCCAGCGGGTGCTCAGGAGGCCCTCAGCGACGGC
CTGCAATTGGAGGTCCAGCCTTCCGAGGAAGAGGCGCGGGGCTACATCGTGACAGACAGA
GACCCCCTGCGCCCCGAGGAAGGAAGGCGGCTGGTGGAGGACGTCGCCCGCCTCCTGCAG
GTGCCCAGCAGTGCGTTCGCTGACGTGGAGGTTCTCGGACCAGCAGTGACCTTCAAAGTG
AGCGCCAATGTCCAAAACGTGACCACTGAGGATGTGGAGAAGGCCACAGTTGACAACAAA
GACAAACTGGAGGAAACCTCTGGACTGAAAATTCTTCAAACCGGAGTCGGGTCGAAAAGC
AAACTCAAGTTCCTGCCTCCTCAGGCGGAGCAAGAAGACTCCACCAAGTTCATCGCGCTC
ACCCTGGTCTCCCTCGCCTGCATCCTGGGCGTCCTCCTGGCCTCTGGCCTCATCTACTGC
CTCCGCCATAGCTCTCAGCACAGGCTGAAGGAGAAGCTCTCGGGACTAGGGGGCGACCCA
GGTGCAGATGCCACTGCCGCCTACCAGGAGCTGTGCCGCCAGCGTATGGCCACGCGGCCA
CCAGACCGACCTGAGGGCCCGCACACGTCACGCATCAGCAGCGTCTCATCCCAGTTCAGC
GACGGGCCGATCCCCAGCCCCTCCGCACGCAGCAGCGCCTCATCCTGGTCCGAGGAGCCT
GTGCAGTCCAACATGGACATCTCCACCGGCCACATGATCCTGTCCTACATGGAGGACCAC
CTGAAGAACAAGAACCGGCTGGAGAAGGAGTGGGAAGCGCTGTGCGCCTACCAGGCGGAG
CCCAACAGCTCGTTCGTGGCCCAGAGGGAGGAGAACGTGCCCAAGAACCGCTCCCTGGCC
GTGCTGACCTATGACCACTCCCGGGTCCTGCTGAAGGCGGAGAACAGCCACAGCCACTCA
GACTACATCAACGCTAGCCCCATCATGGATCACGACCCGAGGAACCCCGCGTACATCGCC
ACCCAGGGACCGCTGCCCGCCACCGTGGCTGACTTTTGGCAGATGGTGTGGGAGAGCGGC
TGCGTGGTGATCGTCATGCTGACACCCCTCGCGGAGAACGGCGTCCGGCAGTGCTACCAC
TACTGGCCGGATGAAGGCTCCAATCTCTACCACATCTATGAGGTGAACCTGGTCTCCGAG
CACATCTGGTGTGAGGACTTCCTGGTGAGGAGCTTCTATCTGAAGAACCTGCAGACCAAC
GAGACGCGCACCGTGACGCAGTTCCACTTCCTGAGTTGGTATGACCGAGGAGTCCCTTCC
TCCTCAAGGTCCCTCCTGGACTTCCGCAGAAAAGTAAACAAGTGCTACAGGGGCCGTTCT
TGTCCAATAATTGTTCATTGCAGTGACGGTGCAGGCCGGAGCGGCACCTACGTCCTGATC
GACATGGTTCTCAACAAGATGGCCAAAGGTGCTAAAGAGATTGATATCGCAGCGACCCTG
GAGCACTTGAGGGACCAGAGACCCGGCATGGTCCAGACGAAGGAGCAGTTTGAGTTCGCG
CTGACAGCCGTGGCTGAGGAGGTGAACGCCATCCTCAAGGCCCTTCCCCAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9677
Chromosome Location7
LocusNot Available
References
  1. Kawasaki E, Hutton JC, Eisenbarth GS: Molecular cloning and characterization of the human transmembrane protein tyrosine phosphatase homologue, phogrin, an autoantigen of type 1 diabetes. Biochem Biophys Res Commun. 1996 Oct 14;227(2):440-7. 8878534
  2. Smith PD, Barker KT, Wang J, Lu YJ, Shipley J, Crompton MR: ICAAR, a novel member of a new family of transmembrane, tyrosine phosphatase-like proteins. Biochem Biophys Res Commun. 1996 Dec 13;229(2):402-11. 8954911
  3. Cui L, Yu WP, DeAizpurua HJ, Schmidli RS, Pallen CJ: Cloning and characterization of islet cell antigen-related protein-tyrosine phosphatase (PTP), a novel receptor-like PTP and autoantigen in insulin-dependent diabetes. J Biol Chem. 1996 Oct 4;271(40):24817-23. 8798755
  4. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. 9205841
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  6. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Lu J, Li Q, Xie H, Chen ZJ, Borovitskaya AE, Maclaren NK, Notkins AL, Lan MS: Identification of a second transmembrane protein tyrosine phosphatase, IA-2beta, as an autoantigen in insulin-dependent diabetes mellitus: precursor of the 37-kDa tryptic fragment. Proc Natl Acad Sci U S A. 1996 Mar 19;93(6):2307-11. 8637868
  9. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  10. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335
  11. Noguera ME, Primo ME, Jakoncic J, Poskus E, Solimena M, Ermacora MR: X-ray structure of the mature ectodomain of phogrin. J Struct Funct Genomics. 2015 Mar;16(1):1-9. doi: 10.1007/s10969-014-9191-0. Epub 2014 Nov 26. 25421040
  12. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974