You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium voltage-gated channel subfamily B member 2
Synonyms
  • Voltage-gated potassium channel subunit Kv2.2
Gene NameKCNB2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008573|Potassium voltage-gated channel subfamily B member 2
MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
LGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFG
QELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLW
DLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQLNDNRQLAHVEAVC
IAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV
QIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDE
DATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANTKD
SADDNHLSPSRWKWARKALSETSSNKSFENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKL
EMLYNEITKTQPHSHPNPDCQEKPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKST
SSIDSFTSCATDFTETERSPLPPPSASHLQMKFPTDLPGTEEHQRARGPPFLTLSREKGP
AARDGTLEYAPVDITVNLDASGSQCGLHSPLQSDNATDSPKSSLKGSNPLKSRSLKVNFK
ENRGSAPQTPPSTARPLPVTTADFSLTTPQHISTILLEETPSQGDRPLLGTEVSAPCQGP
SKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELPGAREEKQVDSSPNCFADKPSD
GRDPLREEGSVGSSSPQDTGHNCRQDIYHAVSEVKKDSSQEGCKMENHLFAPEIHSNPGD
TGYCPTRETSM
Number of residues911
Molecular Weight102561.99
Theoretical pINot Available
GO Classification
Functions
  • delayed rectifier potassium channel activity
  • protein heterodimerization activity
Processes
  • potassium ion transmembrane transport
  • protein homooligomerization
  • regulation of smooth muscle contraction
  • protein targeting to plasma membrane
  • potassium ion transport
  • synaptic transmission
Components
  • perikaryon
  • neuronal cell body membrane
  • intracellular
  • plasma membrane
  • voltage-gated potassium channel complex
  • integral component of membrane
  • dendrite
General FunctionProtein heterodimerization activity
Specific FunctionVoltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and smooth muscle cells. Channels open or close in response to the voltage difference across the membrane, letting potassium ions pass in accordance with their electrochemical gradient. Homotetrameric channels mediate a delayed-rectifier voltage-dependent outward potassium current that display rapid activation and slow inactivation in response to membrane depolarization. Can form functional homotetrameric and heterotetrameric channels that contain variable proportions of KCNB1; channel properties depend on the type of alpha subunits that are part of the channel. Can also form functional heterotetrameric channels with other alpha subunits that are non-conducting when expressed alone, such as KCNS1 and KCNS2, creating a functionally diverse range of channel complexes. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Contributes to the delayed-rectifier voltage-gated potassium current in cortical pyramidal neurons and smooth muscle cells.
Pfam Domain Function
Transmembrane Regions191-212 233-254 266-284 297-317 333-354 396-424
GenBank Protein IDNot Available
UniProtKB IDQ92953
UniProtKB Entry NameKCNB2_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013282|Potassium voltage-gated channel subfamily B member 2 (KCNB2)
ATGGCAGAAAAGGCTCCCCCGGGCTTAAACAGGAAGACTTCAAGGTCGACACTTTCCCTT
CCTCCAGAGCCTGTGGACATTATCCGGAGCAAAACATGCTCCAGGAGAGTTAAGATCAAT
GTGGGGGGCCTCAACCACGAAGTCCTGTGGAGAACGCTGGACAGGCTGCCCAGGACGCGC
CTGGGGAAGCTTCGAGACTGCAACACACACGAGAGCCTCCTGGAAGTGTGCGACGACTAT
AATCTGAACGAGAACGAGTATTTCTTTGATCGGCATCCAGGAGCCTTCACTTCCATTTTA
AATTTCTACCGGACCGGGAAACTCCATATGATGGAAGAAATGTGTGCACTTTCGTTTGGC
CAAGAACTTGATTACTGGGGGATTGATGAGATCTACTTGGAGTCCTGCTGCCAGGCCAGA
TATCATCAAAAAAAAGAACAAATGAACGAAGAACTGAGGCGAGAGGCAGAGACTATGCGA
GAGCGAGAAGGAGAAGAGTTTGATAATACCTGCTGCCCTGATAAAAGGAAGAAACTGTGG
GACTTGCTGGAGAAACCTAACTCATCAGTGGCTGCAAAGATCCTGGCCATCGTGTCTATC
CTGTTCATTGTGCTTTCCACCATTGCTTTGTCTCTCAATACGCTGCCGGAGCTGCAGGAA
ACGGACGAATTTGGACAACTCAATGACAACCGCCAATTAGCACACGTGGAGGCTGTGTGT
ATTGCATGGTTTACCATGGAGTACCTTTTGCGATTCTTATCCTCACCAAATAAATGGAAG
TTCTTCAAAGGCCCACTGAATGTCATTGATTTGCTGGCCATCTTGCCGTACTATGTCACC
ATTTTTCTGACGGAGTCCAACAAGAGCGTGCTGCAGTTCCAAAACGTGAGGCGCGTGGTC
CAGATCTTCCGAATCATGCGCATCCTCAGGATCCTGAAACTCGCCAGGCATTCGACAGGC
CTGCAGTCTCTGGGTTTCACCCTTAGGCGGAGTTACAATGAATTGGGCTTGTTGATATTG
TTTCTGGCCATGGGGATAATGATATTTTCCAGCCTGGTATTTTTTGCTGAGAAGGATGAA
GATGCTACCAAGTTCACCAGTATCCCTGCATCATTTTGGTGGGCCACCATCACCATGACC
ACTGTTGGCTATGGTGACATTTACCCTAAAACATTACTAGGGAAAATTGTGGGAGGTCTG
TGCTGTATTGCTGGGGTTCTGGTTATTGCCCTTCCTATCCCAATTATTGTGAACAATTTT
TCTGAGTTTTACAAGGAGCAGAAACGCCAAGAGAAAGCAATTAAAAGGAGGGAGGCTCTT
GAGCGGGCCAAAAGGAACGGAAGCATCGTTTCTATGAACTTAAAAGATGCCTTCGCTCGA
AGTATGGAACTGATAGATGTGGCTGTTGAGAAGGCCGGAGAGTCCGCCAACACAAAGGAC
TCCGCCGACGATAATCACCTGTCGCCAAGCCGGTGGAAGTGGGCCAGGAAGGCTCTGTCG
GAAACAAGCTCCAACAAGTCTTTCGAGAATAAGTACCAGGAGGTTAGCCAAAAAGACTCC
CACGAGCAGCTGAACAACACGTCTTCCTCCAGCCCACAGCATCTGAGTGCCCAGAAACTG
GAGATGCTATACAATGAAATCACCAAGACACAGCCTCATTCTCACCCAAACCCAGACTGC
CAAGAAAAGCCTGAGAGGCCATCTGCATATGAAGAAGAGATTGAAATGGAAGAAGTGGTG
TGTCCACAGGAGCAGCTGGCCGTGGCACAGACCGAGGTCATTGTGGACATGAAGAGCACC
TCCAGCATCGACAGCTTCACCAGCTGTGCCACCGACTTCACAGAGACAGAGAGATCGCCG
CTGCCGCCGCCCTCCGCCTCTCACTTGCAGATGAAGTTCCCAACCGACCTCCCAGGGACA
GAAGAGCACCAAAGAGCTAGGGGCCCCCCGTTTCTAACTCTATCCAGAGAGAAAGGACCT
GCTGCCAGGGATGGCACGCTGGAGTATGCCCCAGTTGACATAACTGTGAACCTCGATGCC
AGTGGCTCCCAGTGTGGGCTACATAGTCCTTTGCAGTCTGACAATGCCACCGACAGTCCT
AAGAGCTCTCTAAAAGGCAGCAACCCACTAAAGTCCAGATCCCTCAAAGTGAACTTTAAG
GAAAATAGAGGCAGTGCACCACAGACCCCGCCCAGCACAGCCAGGCCACTGCCAGTCACC
ACAGCTGACTTTTCGCTCACTACCCCGCAGCACATCAGTACCATCCTCTTAGAAGAAACC
CCCTCCCAGGGAGACAGACCCTTGCTGGGCACTGAGGTTTCAGCGCCTTGTCAGGGACCT
TCCAAAGGGCTGTCCCCCAGGTTTCCCAAGCAGAAACTGTTCCCTTTCTCTTCAAGAGAG
AGGAGGAGCTTCACTGAAATAGATACTGGTGACGACGAAGACTTCTTAGAGCTCCCAGGG
GCAAGGGAGGAGAAGCAGGTGGACTCCAGCCCAAATTGCTTTGCAGATAAGCCTAGTGAT
GGGAGAGACCCTTTAAGAGAAGAGGGCAGTGTGGGCTCTTCCTCCCCGCAGGACACAGGT
CACAACTGTAGGCAAGACATTTACCATGCTGTGAGTGAAGTCAAAAAGGACAGTAGTCAA
GAAGGGTGCAAGATGGAAAATCACTTGTTTGCCCCAGAAATTCATTCCAACCCAGGAGAC
ACAGGTTATTGTCCCACACGTGAAACCAGCATGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6232
Chromosome Location8
LocusNot Available
References
  1. Schmalz F, Kinsella J, Koh SD, Vogalis F, Schneider A, Flynn ER, Kenyon JL, Horowitz B: Molecular identification of a component of delayed rectifier current in gastrointestinal smooth muscles. Am J Physiol. 1998 May;274(5 Pt 1):G901-11. 9612272
  2. Coetzee WA, Amarillo Y, Chiu J, Chow A, Lau D, McCormack T, Moreno H, Nadal MS, Ozaita A, Pountney D, Saganich M, Vega-Saenz de Miera E, Rudy B: Molecular diversity of K+ channels. Ann N Y Acad Sci. 1999 Apr 30;868:233-85. 10414301
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974