You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameP2Y purinoceptor 11
Synonyms
  • P2Y11
Gene NameP2RY11
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009247|P2Y purinoceptor 11
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
APKPSEPQSRELSQ
Number of residues374
Molecular Weight40344.755
Theoretical pINot Available
GO Classification
Functions
  • ATP-activated adenosine receptor activity
  • G-protein coupled purinergic nucleotide receptor activity
  • receptor activity
  • neurotransmitter receptor activity
Processes
  • neuronal signal transduction
  • adenosine receptor signaling pathway
  • defense response
  • synaptic transmission
  • activation of adenylate cyclase activity
  • G-protein coupled receptor signaling pathway
  • calcium-mediated signaling
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • cellular response to ATP
  • adenylate cyclase-activating G-protein coupled receptor signaling pathway
Components
  • intracellular
  • plasma membrane
  • integral component of plasma membrane
General FunctionReceptor activity
Specific FunctionReceptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.
Pfam Domain Function
Transmembrane Regions30-50 65-85 117-137 147-167 207-227 246-266 309-329
GenBank Protein IDNot Available
UniProtKB IDQ96G91
UniProtKB Entry NameP2Y11_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013695|P2Y purinoceptor 11 (P2RY11)
ATGGCAGCCAACGTCTCGGGTGCCAAGTCCTGCCCTGCCAACTTCTTGGCAGCTGCCGAC
GACAAACTCAGTGGGTTCCAGGGGGACTTCCTGTGGCCCATACTGGTGGTTGAGTTCCTG
GTGGCCGTGGCCAGCAATGGCCTGGCCCTGTACCGCTTCAGCATCCGGAAGCAGCGCCCA
TGGCACCCCGCCGTGGTCTTCTCTGTCCAGCTGGCAGTCAGCGACCTGCTCTGCGCCCTG
ACGCTGCCCCCGCTGGCCGCCTACCTCTATCCCCCCAAGCACTGGCGCTATGGGGAGGCC
GCGTGCCGCCTGGAGCGCTTCCTCTTCACCTGCAACCTGCTGGGCAGCGTCATCTTCATC
ACCTGCATCAGCCTCAACCGCTACCTGGGCATCGTGCACCCCTTCTTCGCCCGAAGCCAC
CTGCGACCCAAGCACGCCTGGGCCGTGAGCGCTGCCGGCTGGGTCCTGGCCGCCCTGCTG
GCCATGCCCACACTCAGCTTCTCCCACCTGAAGAGGCCGCAGCAGGGGGCGGGCAACTGC
AGCGTGGCCAGGCCCGAGGCCTGCATCAAGTGTCTGGGGACAGCAGACCACGGGCTGGCG
GCCTACAGAGCGTATAGCCTGGTGCTGGCGGGGTTGGGCTGCGGCCTGCCGCTGCTGCTC
ACGCTGGCAGCCTACGGCGCCCTCGGGCGGGCCGTGCTACGCAGCCCAGGCATGACTGTG
GCCGAGAAGCTGCGTGTGGCAGCGTTGGTGGCCAGTGGTGTGGCCCTCTACGCCAGCTCC
TATGTGCCCTACCACATCATGCGGGTGCTCAACGTGGATGCTCGGCGGCGCTGGAGCACC
CGCTGCCCGAGCTTTGCAGACATAGCCCAGGCCACAGCAGCCCTGGAGCTGGGGCCCTAC
GTGGGCTACCAGGTGATGCGGGGCCTCATGCCCCTGGCCTTCTGTGTCCACCCTCTACTC
TACATGGCCGCAGTGCCCAGCCTGGGCTGCTGCTGCCGACACTGCCCCGGCTACAGGGAC
AGCTGGAACCCAGAGGACGCCAAGAGCACTGGCCAAGCCCTGCCCCTCAATGCCACAGCC
GCCCCTAAACCGTCAGAGCCCCAGTCCCGTGAGCTGAGCCAATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8540
Chromosome Location19
LocusNot Available
References
  1. Communi D, Suarez-Huerta N, Dussossoy D, Savi P, Boeynaems JM: Cotranscription and intergenic splicing of human P2Y11 and SSF1 genes. J Biol Chem. 2001 May 11;276(19):16561-6. Epub 2001 Feb 5. 11278528
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Communi D, Govaerts C, Parmentier M, Boeynaems JM: Cloning of a human purinergic P2Y receptor coupled to phospholipase C and adenylyl cyclase. J Biol Chem. 1997 Dec 19;272(51):31969-73. 9405388