Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameATPase family AAA domain-containing protein 5
Synonyms
  • C17orf41
  • Chromosome fragility-associated gene 1 protein
  • FRAG1
Gene NameATAD5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009301|ATPase family AAA domain-containing protein 5
MVGVLAMAAAAAPPPVKDCEIEPCKKRKKDDDTSTCKTITKYLSPLGKTRDRVFAPPKPS
NILDYFRKTSPTNEKTQLGKECKIKSPESVPVDSNKDCTTPLEMFSNVEFKKKRKRVNLS
HQLNNIKTENEAPIEISSDDSKEDYSLNNDFVESSTSVLRYKKQVEVLAENIQDTKSQPN
TMTSLQNSKKVNPKQGTTKNDFKKLRKRKCRDVVDLSESLPLAEELNLLKKDGKDTKQME
NTTSHANSRDNVTEAAQLNDSIITVSYEEFLKSHKENKVEEIPDSTMSICVPSETVDEIV
KSGYISESENSEISQQVRFKTVTVLAQVHPIPPKKTGKIPRIFLKQKQFEMENSLSDPEN
EQTVQKRKSNVVIQEEELELAVLEAGSSEAVKPKCTLEERQQFMKAFRQPASDALKNGVK
KSSDKQKDLNEKCLYEVGRDDNSKKIMENSGIQMVSKNGNLQLHTDKGSFLKEKNKKLKK
KNKKTLDTGAIPGKNREGNTQKKETTFFLKEKQYQNRMSLRQRKTEFFKSSTLFNNESLV
YEDIANDDLLKVSSLCNNNKLSRKTSIPVKDIKLTQSKAESEASLLNVSTPKSTRRSGRI
SSTPTTETIRGIDSDDVQDNSQLKASTQKAANLSEKHSLYTAELITVPFDSESPIRMKFT
RISTPKKSKKKSNKRSEKSEATDGGFTSQIRKASNTSKNISKAKQLIEKAKALHISRSKV
TEEIAIPLRRSSRHQTLPERKKLSETEDSVIIIDSSPTALKHPEKNQKKLQCLNDVLGKK
LNTSTKNVPGKMKVAPLFLVRKAQKAADPVPSFDESSQDTSEKSQDCDVQCKAKRDFLMS
GLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDGCCLWHLKPPSCPLLTKFKELN
TKVIDLSKCGIALGEFSTLNSKLKSGNSAAVFMRTRKEFTEEVRNLLLEEIRWSNPEFSL
KKYFPLLLKKQIEHQVLSSECHSKQELEADVSHKETKRKLVEAENSKSKRKKPNEYSKNL
EKTNRKSEELSKRNNSSGIKLDSSKDSGTEDMLWTEKYQPQTASELIGNELAIKKLHSWL
KDWKRRAELEERQNLKGKRDEKHEDFSGGIDFKGSSDDEEESRLCNTVLITGPTGVGKTA
AVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKPCFFNSYYIGK
SPKKISSPKKVVTSPRKVPPPSPKSSGPKRALPPKTLANYFKVSPKPKNNEEIGMLLENN
KGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNA
IKTFMATTKRPVILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVK
DFVTLLTANTCDIRKSILYLQFWIRSGGGVLEERPLTLYRGNSRNVQLVCSEHGLDNKIY
PKNTKKKRVDLPKCDSGCAETLFGLKNIFSPSEDLFSFLKHKITMKEEWHKFIQLLTEFQ
MRNVDFLYSNLEFILPLPVDTIPETKNFCGPSVTVDASAATKSMNCLARKHSEREQPLKK
SQKKKQKKTLVILDDSDLFDTDLDFPDQSISLSSVSSSSNAEESKTGDEESKARDKGNNP
ETKKSIPCPPKTTAGKKCSALVSHCLNSLSEFMDNMSFLDALLTDVREQNKYGRNDFSWT
NGKVTSGLCDEFSLESNDGWTSQSSGELKAAAEALSFTKCSSAISKALETLNSCKKLGRD
PTNDLTFYVSQKRNNVYFSQSAANLDNAWKRISVIKSVFSSRSLLYVGNRQASIIEYLPT
LRNICKTEKLKEQGKSKRRFLHYFEGIHLDIPKETVNTLAADFP
Number of residues1844
Molecular Weight207568.185
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
Processes
  • cellular response to DNA damage stimulus
Components
  • nucleus
General FunctionAtp binding
Specific FunctionInvolved in DNA damage response. Involved in a RAD9A-related damage checkpoint, a pathway that is important in determining whether DNA damage is compatible with cell survival or whether it requires cell elimination by apoptosis. Modulates the RAD9A interaction with BCL2 and thereby induces DNA damages-induced apoptosis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ96QE3
UniProtKB Entry NameATAD5_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013728|ATPase family AAA domain-containing protein 5 (ATAD5)
ATGGTGGGGGTCCTGGCCATGGCGGCTGCAGCTGCTCCGCCTCCCGTGAAGGACTGCGAG
ATTGAGCCATGCAAAAAGCGAAAGAAAGATGATGACACATCTACCTGCAAAACAATTACA
AAATATTTATCACCACTAGGGAAGACTAGAGACAGGGTTTTTGCTCCACCAAAACCTAGT
AATATTCTGGATTATTTTAGAAAGACTTCACCCACAAATGAGAAGACACAATTAGGGAAA
GAGTGCAAGATAAAGTCACCTGAATCAGTACCTGTTGACAGCAACAAAGACTGTACGACA
CCTTTGGAAATGTTCTCAAATGTAGAGTTTAAGAAGAAAAGAAAGAGGGTTAATTTATCT
CATCAACTAAATAATATTAAAACTGAAAATGAAGCTCCAATTGAAATTAGTAGCGACGAT
AGCAAAGAAGACTATAGTTTAAATAATGATTTTGTGGAAAGTAGTACTTCTGTTTTACGT
TACAAGAAACAAGTAGAGGTACTTGCAGAAAACATTCAAGATACAAAAAGTCAACCAAAT
ACTATGACCTCCCTGCAAAATTCTAAAAAAGTAAATCCTAAACAAGGGACCACAAAAAAT
GACTTCAAAAAGTTGAGAAAAAGGAAATGCAGAGATGTAGTAGATCTATCTGAAAGCTTA
CCCTTGGCAGAGGAACTAAATTTGCTTAAAAAAGATGGTAAAGATACTAAACAGATGGAG
AATACTACAAGCCATGCAAACTCTAGAGATAACGTAACTGAAGCAGCCCAGTTAAATGAT
AGTATAATAACTGTCTCATATGAGGAATTTTTAAAAAGTCACAAGGAAAATAAAGTGGAA
GAGATACCAGACTCTACAATGTCAATTTGTGTTCCTTCTGAAACTGTCGACGAAATAGTC
AAAAGTGGTTATATAAGTGAATCAGAAAACTCCGAAATTTCCCAGCAGGTACGCTTTAAG
ACAGTTACTGTTCTTGCACAGGTTCACCCTATTCCGCCCAAAAAGACAGGGAAAATACCC
CGAATTTTCTTGAAACAAAAGCAATTTGAAATGGAAAATAGTTTATCTGATCCTGAGAAT
GAACAGACAGTTCAGAAAAGAAAATCTAATGTTGTTATACAGGAGGAAGAATTAGAATTG
GCTGTTTTGGAAGCTGGAAGTTCTGAAGCTGTGAAACCAAAATGCACTCTAGAAGAAAGA
CAGCAATTTATGAAAGCATTTAGGCAGCCAGCATCAGATGCACTTAAAAATGGAGTTAAA
AAGTCTTCTGATAAGCAGAAAGACCTTAATGAAAAATGTCTATATGAAGTAGGAAGAGAT
GATAATTCTAAAAAAATCATGGAAAATTCTGGTATCCAAATGGTTTCAAAAAATGGCAAT
TTACAGTTACACACTGATAAAGGAAGTTTTCTGAAGGAGAAAAATAAAAAGCTAAAGAAG
AAGAATAAGAAAACATTAGATACTGGGGCTATTCCAGGCAAAAACAGAGAGGGAAACACT
CAAAAGAAAGAAACAACCTTTTTCTTAAAAGAGAAACAATATCAAAATAGAATGAGTTTA
AGACAAAGGAAAACAGAGTTTTTCAAAAGCAGCACTTTATTTAACAATGAAAGTCTTGTT
TATGAAGATATAGCAAATGATGACCTTCTAAAGGTTTCCTCTCTGTGTAACAATAATAAA
TTGTCAAGAAAAACCAGCATACCAGTTAAAGATATTAAGCTTACACAGTCTAAAGCTGAA
TCTGAAGCCAGCTTGCTAAATGTTTCCACGCCCAAGTCAACTAGAAGATCTGGAAGAATT
AGCAGCACACCTACTACAGAAACCATTAGAGGTATTGATTCTGACGATGTACAAGATAAT
AGTCAACTAAAGGCTTCCACTCAAAAAGCAGCCAACTTATCGGAAAAGCACAGCTTATAT
ACAGCAGAATTAATAACAGTACCCTTTGATTCAGAGAGCCCTATTAGAATGAAATTCACC
AGAATTAGTACTCCCAAAAAATCTAAGAAAAAATCTAACAAAAGATCTGAGAAATCTGAA
GCAACTGATGGAGGTTTTACTTCTCAGATTAGAAAGGCAAGCAATACTTCAAAAAACATA
TCAAAAGCAAAACAATTGATTGAAAAAGCAAAAGCTTTACACATCAGTAGGTCAAAGGTG
ACTGAAGAAATAGCGATACCCTTAAGGCGCTCCTCTAGACATCAGACACTTCCTGAAAGG
AAGAAATTGTCAGAAACAGAAGATTCTGTTATAATAATAGATTCAAGTCCTACTGCTTTA
AAGCATCCAGAGAAAAATCAGAAGAAACTTCAGTGTTTGAATGATGTGCTAGGAAAAAAA
CTTAACACATCCACTAAAAATGTACCTGGAAAAATGAAAGTCGCTCCTTTATTTCTTGTC
AGAAAAGCACAAAAAGCAGCTGATCCTGTCCCTAGTTTTGATGAAAGCAGTCAAGATACA
TCTGAAAAATCTCAGGATTGTGATGTTCAATGTAAAGCAAAGCGTGACTTCCTAATGAGT
GGTTTGCCAGATTTGTTGAAACGGCAAATTGCAAAGAAAGCTGCTGCGCTGGATGTGTAC
AATGCAGTGAGTACCAGTTTCCAGAGAGTCGTACATGTGCAACAAAAGGATGATGGGTGT
TGTTTGTGGCATTTGAAACCACCCTCTTGTCCTCTCTTAACTAAATTTAAAGAACTGAAC
ACTAAAGTAATAGATCTCTCAAAATGTGGTATTGCTCTTGGTGAATTTTCAACATTGAAT
TCAAAGTTGAAAAGCGGTAACTCTGCTGCTGTGTTCATGAGGACAAGGAAGGAATTTACT
GAAGAAGTAAGAAATCTTTTGCTTGAGGAAATTAGGTGGTCAAATCCTGAATTTTCATTG
AAAAAATATTTTCCCTTACTCCTAAAAAAACAAATTGAGCACCAAGTACTTTCTTCCGAG
TGTCATAGTAAACAAGAACTGGAGGCTGATGTCAGCCATAAAGAAACCAAAAGGAAACTC
GTAGAAGCAGAAAATTCTAAGTCAAAAAGAAAGAAACCAAATGAGTATTCAAAAAATCTG
GAGAAGACCAATAGGAAGTCAGAAGAACTTAGCAAAAGAAACAACTCTTCTGGGATAAAG
CTAGATTCTTCCAAAGATTCTGGAACTGAAGACATGCTTTGGACAGAAAAGTATCAACCT
CAGACTGCCAGTGAACTTATAGGAAATGAGTTAGCTATAAAAAAGTTACATAGTTGGTTG
AAAGACTGGAAAAGAAGAGCTGAATTGGAAGAAAGGCAGAATCTGAAGGGAAAAAGAGAT
GAGAAACATGAAGATTTCTCGGGTGGCATAGACTTTAAAGGCAGTTCAGATGATGAAGAA
GAGAGTCGTCTTTGCAATACTGTCCTTATAACAGGGCCAACAGGAGTGGGAAAAACTGCT
GCAGTGTATGCTTGTGCCCAGGAGCTTGGATTTAAGATATTTGAAGTGAATGCCTCTTCC
CAGCGCAGTGGTAGACAAATTCTATCTCAGTTGAAGGAAGCTACTCAGTCCCATCAAGTA
GACAAACAAGGTGTAAACTCACAAAAACCCTGTTTTTTTAATAGCTACTACATAGGCAAG
TCACCAAAAAAAATAAGCTCCCCTAAGAAAGTTGTTACATCACCAAGAAAAGTTCCTCCA
CCATCACCAAAAAGTAGTGGACCAAAGCGAGCACTTCCTCCCAAAACCTTGGCAAATTAT
TTTAAAGTATCTCCCAAACCTAAAAATAATGAAGAAATAGGAATGCTTCTGGAAAATAAT
AAAGGAATAAAAAATTCTTTTGAACAGAAACAAATTACTCAGACTAAATCTACAAATGCA
ACTAATTCAAATGTCAAAGACGTTGGAGCTGAAGAACCCAGCAGAAAAAATGCAACATCT
CTTATTCTTTTTGAGGAGGTTGATGTAATTTTTGATGAAGATGCTGGGTTTTTGAATGCA
ATCAAAACATTCATGGCAACAACTAAACGACCTGTAATCCTTACTACAAGTGACCCAACA
TTTAGTTTAATGTTTGATGGCTGCTTTGAAGAAATCAAGTTCAGTACTCCTTCCCTGCTA
AATGTTGCCAGCTACCTACAAATGATTTGCTTAACTGAGAATTTTAGAACTGATGTAAAA
GACTTTGTAACCTTGTTAACTGCAAATACTTGTGATATCAGAAAAAGTATCCTTTACTTA
CAATTCTGGATTAGAAGTGGAGGTGGAGTTTTAGAAGAACGACCATTAACCCTTTATCGT
GGAAATAGCAGAAATGTACAACTAGTTTGCTCTGAACATGGCCTTGATAACAAAATTTAC
CCTAAAAATACTAAAAAGAAACGTGTAGACCTTCCAAAATGTGACAGTGGCTGTGCTGAG
ACCTTGTTTGGCCTTAAGAACATTTTTTCCCCATCTGAAGACTTATTTTCATTTTTAAAG
CACAAAATCACAATGAAGGAAGAATGGCATAAATTCATCCAGCTTCTTACAGAATTCCAA
ATGCGGAATGTAGATTTTTTATATAGTAATCTTGAGTTTATTCTACCATTACCAGTTGAT
ACCATTCCAGAAACTAAAAACTTTTGTGGCCCATCAGTAACTGTGGATGCCAGTGCAGCA
ACAAAAAGTATGAATTGTCTTGCTAGGAAACACTCTGAAAGAGAACAGCCATTGAAAAAG
TCCCAGAAAAAGAAACAAAAGAAAACATTGGTAATATTAGATGATAGTGATCTATTTGAC
ACTGACTTGGACTTTCCTGATCAATCTATTAGCCTGTCCTCTGTATCATCTTCCTCAAAT
GCAGAAGAAAGCAAAACCGGAGACGAAGAAAGCAAAGCCAGAGACAAAGGAAACAATCCA
GAGACAAAGAAATCTATTCCTTGTCCTCCTAAAACAACTGCAGGAAAAAAATGTTCTGCC
CTTGTTTCTCATTGTTTAAATTCTCTCTCTGAGTTCATGGATAACATGTCCTTCTTAGAT
GCACTTTTAACTGATGTAAGGGAACAAAACAAATACGGTAGAAATGACTTTAGTTGGACA
AATGGAAAGGTTACAAGTGGACTTTGTGATGAGTTTAGTCTTGAGAGTAATGATGGATGG
ACTTCTCAAAGCTCTGGAGAATTAAAGGCAGCTGCAGAAGCTCTCAGCTTTACTAAATGT
TCTTCTGCTATTTCAAAAGCATTGGAAACCTTGAATTCTTGCAAGAAATTAGGAAGAGAT
CCAACCAACGATCTTACTTTTTATGTTTCACAAAAGCGCAATAATGTATACTTTAGTCAG
TCAGCAGCTAATTTAGACAATGCTTGGAAGAGGATATCAGTCATTAAAAGTGTATTTTCG
AGTCGATCTCTTCTCTATGTGGGTAATAGACAAGCTAGTATAATTGAATACCTGCCAACC
CTTCGAAACATCTGTAAGACTGAGAAGCTAAAAGAACAAGGAAAAAGTAAAAGAAGATTC
CTGCACTATTTTGAAGGAATTCATCTTGACATTCCAAAAGAGACTGTGAATACTTTGGCA
GCTGACTTCCCTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:25752
Chromosome Location17
LocusNot Available
References
  1. Jenne DE, Tinschert S, Reimann H, Lasinger W, Thiel G, Hameister H, Kehrer-Sawatzki H: Molecular characterization and gene content of breakpoint boundaries in patients with neurofibromatosis type 1 with 17q11.2 microdeletions. Am J Hum Genet. 2001 Sep;69(3):516-27. Epub 2001 Jul 20. 11468690
  2. Ishii H, Inageta T, Mimori K, Saito T, Sasaki H, Isobe M, Mori M, Croce CM, Huebner K, Ozawa K, Furukawa Y: Frag1, a homolog of alternative replication factor C subunits, links replication stress surveillance with apoptosis. Proc Natl Acad Sci U S A. 2005 Jul 5;102(27):9655-60. Epub 2005 Jun 27. 15983387
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  10. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  11. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  12. Rahman S, Sowa ME, Ottinger M, Smith JA, Shi Y, Harper JW, Howley PM: The Brd4 extraterminal domain confers transcription activation independent of pTEFb by recruiting multiple proteins, including NSD3. Mol Cell Biol. 2011 Jul;31(13):2641-52. doi: 10.1128/MCB.01341-10. Epub 2011 May 9. 21555454
  13. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692