You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameChloride channel CLIC-like protein 1
Synonyms
  • KIAA0761
  • MCLC
  • Mid-1-related chloride channel protein 1
Gene NameCLCC1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037300|Chloride channel CLIC-like protein 1
MLCSLLLCECLLLVAGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSC
ADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGD
MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGV
DPYNVLMVLLCLLCIVVLVATELWTYVRWYTQLRRVLIISFLFSLGWNWMYLYKLAFAQH
QAEVAKMEPLNNVCAKKMDWTGSIWEWFRSSWTYKDDPCQKYYELLLVNPIWLVPPTKAL
AVTFTTFVTEPLKHIGKGTGEFIKALMKEIPALLHLPVLIIMALAILSFCYGAGKSVHVL
RHIGGPESEPPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRR
EILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGE
GTPKESSTESSQSAKPVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGP
RGQDPVSSPCG
Number of residues551
Molecular Weight62021.97
Theoretical pINot Available
GO Classification
Functions
  • chloride channel activity
Components
  • nucleus
  • endoplasmic reticulum
  • Golgi apparatus
  • intracellular membrane-bounded organelle
  • chloride channel complex
  • membrane
General FunctionChloride channel activity
Specific FunctionSeems to act as a chloride ion channel.
Pfam Domain Function
Transmembrane Regions185-205 217-237 330-350
GenBank Protein IDNot Available
UniProtKB IDQ96S66
UniProtKB Entry NameCLCC1_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013973|Chloride channel CLIC-like protein 1 (CLCC1)
ATGCTGTGTTCTTTGCTCCTTTGTGAATGTCTGTTGCTGGTAGCTGGTTATGCTCATGAT
GATGACTGGATTGACCCCACAGACATGCTTAACTATGATGCTGCTTCAGGAACAATGAGA
AAATCTCAGGCAAAATATGGTATTTCAGGGGAAAAGGATGTCAGTCCTGACTTGTCATGT
GCTGATGAAATATCAGAATGTTATCACAAACTTGATTCTTTAACTTATAAGATTGATGAG
TGTGAAAAGAAAAAGAGGGAAGACTATGAAAGTCAAAGCAATCCTGTTTTTAGGAGATAC
TTAAATAAGATTTTAATTGAAGCTGGAAAGCTTGGACTTCCTGATGAAAACAAAGGCGAT
ATGCATTATGATGCTGAGATTATCCTTAAAAGAGAAACTTTGTTAGAAATACAGAAGTTT
CTCAATGGAGAAGACTGGAAACCAGGTGCCTTGGATGATGCACTAAGTGATATTTTAATT
AATTTTAAGTTTCATGATTTTGAAACATGGAAGTGGCGATTCGAAGATTCCTTTGGAGTG
GATCCATATAATGTGTTAATGGTACTTCTTTGTCTGCTCTGCATCGTGGTTTTAGTGGCT
ACTGAGCTGTGGACATATGTACGTTGGTACACTCAGTTGAGACGTGTTTTAATCATCAGC
TTTCTGTTCAGTTTGGGATGGAATTGGATGTATTTATATAAGCTAGCTTTTGCACAGCAT
CAGGCTGAAGTCGCCAAGATGGAGCCATTAAACAATGTGTGTGCCAAAAAGATGGACTGG
ACTGGAAGTATCTGGGAATGGTTTAGAAGTTCATGGACCTATAAGGATGACCCATGCCAA
AAATACTATGAGCTCTTACTAGTCAACCCTATTTGGTTGGTCCCACCAACAAAGGCACTT
GCAGTTACATTCACCACATTTGTAACGGAGCCATTGAAGCATATTGGAAAAGGAACTGGG
GAATTTATTAAAGCACTCATGAAGGAAATTCCAGCGCTGCTTCATCTTCCAGTGCTGATA
ATTATGGCATTAGCCATCCTGAGTTTCTGCTATGGTGCTGGAAAATCAGTTCATGTGCTG
AGACATATAGGCGGTCCTGAGAGCGAACCTCCCCAGGCACTTCGGCCACGGGATAGAAGA
CGGCAGGAGGAAATTGATTATAGACCTGATGGTGGAGCAGGTGATGCCGATTTCCATTAT
AGGGGCCAAATGGGCCCCACTGAGCAAGGCCCTTATGCCAAAACGTATGAGGGTAGAAGA
GAGATTTTGAGAGAGAGAGATGTTGACTTGAGATTTCAGACTGGCAACAAGAGCCCTGAA
GTGCTCCGGGCATTTGATGTACCAGACGCAGAGGCACGAGAGCATCCCACGGTGGTACCC
AGTCATAAATCACCTGTTTTGGATACAAAGCCCAAGGAGACAGGTGGAATCCTGGGGGAA
GGCACACCGAAAGAAAGCAGTACTGAAAGCAGCCAGTCGGCCAAGCCTGTCTCTGGCCAA
GACACATCAGGGAATACAGAAGGTTCACCCGCAGCGGAAAAGGCCCAGCTCAAGTCTGAA
GCCGCAGGCAGCCCAGACCAAGGCAGCACATACAGCCCCGCAAGAGGTGTGGCTGGACCA
CGTGGACAGGATCCGGTCAGCAGCCCCTGTGGCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29675
Chromosome Location1
LocusNot Available
References
  1. Nagasawa M, Kanzaki M, Iino Y, Morishita Y, Kojima I: Identification of a novel chloride channel expressed in the endoplasmic reticulum, golgi apparatus, and nucleus. J Biol Chem. 2001 Jun 8;276(23):20413-8. Epub 2001 Mar 5. 11279057
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. 9872452
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  6. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. 17924679
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  12. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569