You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMelanin-concentrating hormone receptor 1
Synonyms
  • G-protein coupled receptor 24
  • GPR24
  • MCH receptor 1
  • MCH-1R
  • MCH1R
  • MCHR
  • SLC-1
  • SLC1
  • Somatostatin receptor-like protein
Gene NameMCHR1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006750|Melanin-concentrating hormone receptor 1
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Number of residues422
Molecular Weight45962.185
Theoretical pI9.13
GO Classification
Functions
  • G-protein coupled receptor activity
  • neuropeptide receptor activity
  • melanin-concentrating hormone receptor activity
Processes
  • cell surface receptor signaling pathway
  • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
  • feeding behavior
  • generation of precursor metabolites and energy
  • positive regulation of cytosolic calcium ion concentration
  • G-protein coupled receptor signaling pathway
Components
  • ciliary membrane
  • nonmotile primary cilium
  • plasma membrane
  • cytosol
  • integral component of plasma membrane
General FunctionNeuropeptide receptor activity
Specific FunctionReceptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
Pfam Domain Function
Transmembrane Regions114-136 149-171 186-208 228-250 279-301 322-344 359-381
GenBank Protein IDNot Available
UniProtKB IDQ99705
UniProtKB Entry NameMCHR1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0012427|Melanin-concentrating hormone receptor 1 (MCHR1)
ATGTCAGTGGGAGCCATGAAGAAGGGAGTGGGGAGGGCAGTTGGGCTTGGAGGCGGCAGC
GGCTGCCAGGCTACGGAGGAAGACCCCCTTCCCAACTGCGGGGCTTGCGCTCCGGGACAA
GGTGGCAGGCGCTGGAGGCTGCCGCAGCCTGCGTGGGTGGAGGGGAGCTCAGCTCGGTTG
TGGGAGCAGGCGACCGGCACTGGCTGGATGGACCTGGAAGCCTCGCTGCTGCCCACTGGT
CCCAACGCCAGCAACACCTCTGATGGCCCCGATAACCTCACTTCGGCAGGATCACCTCCT
CGCACGGGGAGCATCTCCTACATCAACATCATCATGCCTTCGGTGTTCGGCACCATCTGC
CTCCTGGGCATCATCGGGAACTCCACGGTCATCTTCGCGGTCGTGAAGAAGTCCAAGCTG
CACTGGTGCAACAACGTCCCCGACATCTTCATCATCAACCTCTCGGTAGTAGATCTCCTC
TTTCTCCTGGGCATGCCCTTCATGATCCACCAGCTCATGGGCAATGGGGTGTGGCACTTT
GGGGAGACCATGTGCACCCTCATCACGGCCATGGATGCCAATAGTCAGTTCACCAGCACC
TACATCCTGACCGCCATGGCCATTGACCGCTACCTGGCCACTGTCCACCCCATCTCTTCC
ACGAAGTTCCGGAAGCCCTCTGTGGCCACCCTGGTGATCTGCCTCCTGTGGGCCCTCTCC
TTCATCAGCATCACCCCTGTGTGGCTGTATGCCAGACTCATCCCCTTCCCAGGAGGTGCA
GTGGGCTGCGGCATACGCCTGCCCAACCCAGACACTGACCTCTACTGGTTCACCCTGTAC
CAGTTTTTCCTGGCCTTTGCCCTGCCTTTTGTGGTCATCACAGCCGCATACGTGAGGATC
CTGCAGCGCATGACGTCCTCAGTGGCCCCCGCCTCCCAGCGCAGCATCCGGCTGCGGACA
AAGAGGGTGACCCGCACAGCCATCGCCATCTGTCTGGTCTTCTTTGTGTGCTGGGCACCC
TACTATGTGCTACAGCTGACCCAGTTGTCCATCAGCCGCCCGACCCTCACCTTTGTCTAC
TTATACAATGCGGCCATCAGCTTGGGCTATGCCAACAGCTGCCTCAACCCCTTTGTGTAC
ATCGTGCTCTGTGAGACGTTCCGCAAACGCTTGGTCCTGTCGGTGAAGCCTGCAGCCCAG
GGGCAGCTTCGCGCTGTCAGCAACGCTCAGACGGCTGACGAGGAGAGGACAGAAAGCAAA
GGCACCTGA
GenBank Gene IDU71092
GeneCard IDNot Available
GenAtlas IDMCHR1
HGNC IDHGNC:4479
Chromosome Location22
LocusNot Available
References
  1. Shimomura Y, Mori M, Sugo T, Ishibashi Y, Abe M, Kurokawa T, Onda H, Nishimura O, Sumino Y, Fujino M: Isolation and identification of melanin-concentrating hormone as the endogenous ligand of the SLC-1 receptor. Biochem Biophys Res Commun. 1999 Aug 11;261(3):622-6. 10441476
  2. Wermter AK, Reichwald K, Buch T, Geller F, Platzer C, Huse K, Hess C, Remschmidt H, Gudermann T, Preibisch G, Siegfried W, Goldschmidt HP, Li WD, Price RA, Biebermann H, Krude H, Vollmert C, Wichmann HE, Illig T, Sorensen TI, Astrup A, Larsen LH, Pedersen O, Eberle D, Clement K, Blundell J, Wabitsch M, Schafer H, Platzer M, Hinney A, Hebebrand J: Mutation analysis of the MCHR1 gene in human obesity. Eur J Endocrinol. 2005 Jun;152(6):851-62. 15941924
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Kolakowski LF Jr, Jung BP, Nguyen T, Johnson MP, Lynch KR, Cheng R, Heng HH, George SR, O'Dowd BF: Characterization of a human gene related to genes encoding somatostatin receptors. FEBS Lett. 1996 Dec 2;398(2-3):253-8. 8977118
  8. Chambers J, Ames RS, Bergsma D, Muir A, Fitzgerald LR, Hervieu G, Dytko GM, Foley JJ, Martin J, Liu WS, Park J, Ellis C, Ganguly S, Konchar S, Cluderay J, Leslie R, Wilson S, Sarau HM: Melanin-concentrating hormone is the cognate ligand for the orphan G-protein-coupled receptor SLC-1. Nature. 1999 Jul 15;400(6741):261-5. 10421367
  9. Francke F, Ward RJ, Jenkins L, Kellett E, Richter D, Milligan G, Bachner D: Interaction of neurochondrin with the melanin-concentrating hormone receptor 1 interferes with G protein-coupled signal transduction but not agonist-mediated internalization. J Biol Chem. 2006 Oct 27;281(43):32496-507. Epub 2006 Aug 31. 16945926
  10. Gibson WT, Pissios P, Trombly DJ, Luan J, Keogh J, Wareham NJ, Maratos-Flier E, O'Rahilly S, Farooqi IS: Melanin-concentrating hormone receptor mutations and human obesity: functional analysis. Obes Res. 2004 May;12(5):743-9. 15166293
  11. Hawes BE, Green B, O'Neill K, Fried S, Arreaza MG, Qiu P, Simon JS: Identification and characterization of single-nucleotide polymorphisms in MCH-R1 and MCH-R2. Obes Res. 2004 Aug;12(8):1327-34. 15340116