Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGamma-aminobutyric acid receptor subunit gamma-3
Synonyms
  • GABA(A) receptor subunit gamma-3
Gene NameGABRG3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006921|Gamma-aminobutyric acid receptor subunit gamma-3
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS
TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS
SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC
YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL
Number of residues467
Molecular Weight54288.16
Theoretical pI7.58
GO Classification
Functions
  • GABA-A receptor activity
  • inhibitory extracellular ligand-gated ion channel activity
  • chloride channel activity
Processes
  • response to drug
  • chloride transmembrane transport
  • regulation of membrane potential
  • gamma-aminobutyric acid signaling pathway
  • neurological system process
  • synaptic transmission
  • transmembrane transport
  • ion transmembrane transport
Components
  • plasma membrane
  • chloride channel complex
  • GABA-A receptor complex
  • cell junction
  • integral component of plasma membrane
  • synapse
  • postsynaptic membrane
  • neuron projection
General FunctionInhibitory extracellular ligand-gated ion channel activity
Specific FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions255-277 281-303 315-337 444-467
GenBank Protein ID1754749
UniProtKB IDQ99928
UniProtKB Entry NameGBRG3_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0012498|Gamma-aminobutyric acid receptor subunit gamma-3 (GABRG3)
ATGGCCCCGAAGCTGCTGCTCCTCCTCTGCCTGTTCTCGGGCTTGCACGCGCGGTCCAGA
AAGGTGGAAGAGGATGAATATGAAGATTCATCATCAAACCAAAAGTGGGTCTTGGCTCCA
AAATCCCAAGACACCGACGTGACTCTTATTCTCAACAAGTTGCTAAGAGAATATGATAAA
AAGCTGAGGCCAGATATTGGAATAAAACCGACCGTAATTGACGTTGACATTTATGTTAAC
AGCATTGGTCCTGTGTCATCAATAAACATGGAATACCAAATTGACATATTTTTTGCTCAG
ACCTGGACAGATAGTCGCCTTCGATTCAACAGCACAATGAAAATTCTTACTCTGAACAGC
AACATGGTGGGGTTAATCTGGATCCCAGACACCATCTTCCGCAATTCTAAAACCGCAGAG
GCTCACTGGATCACCACACCCAATCAGCTCCTCCGGATTTGGAATGACGGGAAAATCCTT
TACACTTTGAGGCTCACCATCAATGCTGAGTGCCAGCTGCAGCTGCACAACTTCCCCATG
GACGAACACTCCTGCCCGCTGATTTTCTCCAGCTATGGCTATCCCAAAGAAGAAATGATT
TATAGATGGAGAAAAAATTCAGTGGAGGCAGCTGACCAGAAATCATGGCGGCTTTATCAG
TTTGACTTCATGGGCCTCAGAAACACCACAGAAATCGTGACAACGTCTGCAGGTAGGAAT
TTACTGAAAGAGGCACAGCTCTCAAAAGCCAGAGAGGCCTAA
GenBank Gene IDS82769
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4088
Chromosome Location15
Locus15q12
References
  1. Hadingham KL, Wafford KA, Thompson SA, Palmer KJ, Whiting PJ: Expression and pharmacology of human GABAA receptors containing gamma 3 subunits. Eur J Pharmacol. 1995 Nov 30;291(3):301-9. 8719414
  2. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334