You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent calcium channel gamma-6 subunit
Synonyms
  • Neuronal voltage-gated calcium channel gamma-6 subunit
Gene NameCACNG6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017616|Voltage-dependent calcium channel gamma-6 subunit
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE
FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF
TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL
LTLPSWPWGSLCPKRGHRAT
Number of residues260
Molecular Weight28128.745
Theoretical pINot Available
GO Classification
Functions
  • voltage-gated calcium channel activity
Processes
  • calcium ion transport
Components
  • voltage-gated calcium channel complex
General FunctionVoltage-gated calcium channel activity
Specific FunctionThought to stabilize the calcium channel in an inactivated (closed) state.
Pfam Domain Function
Transmembrane Regions43-63 143-163 169-189 221-241
GenBank Protein IDNot Available
UniProtKB IDQ9BXT2
UniProtKB Entry NameCCG6_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0017617|Voltage-dependent calcium channel gamma-6 subunit (CACNG6)
ATGATGTGGTCCAACTTCTTCCTGCAAGAGGAGAACCGGCGGCGGGGGGCCGCGGGCCGG
CGGCGGGCGCACGGGCAGGGCAGGTCGGGGCTGACGCCCGAGCGCGAGGGGAAGGTGAAG
CTGGCGCTGCTGCTGGCCGCCGTGGGCGCCACGCTGGCGGTGCTGTCCGTGGGCACCGAG
TTCTGGGTGGAGCTCAACACCTACAAGGCCAACGGCAGCGCCGTGTGCGAAGCGGCCCAC
CTGGGGCTGTGGAAGGCGTGCACCAAGCGGCTGTGGCAGGCGGACGTGCCCGTGGACAGG
GACACCTGCGGCCCCGCGGAGCTGCCCGGAGGCCTGCTGCTCTTGGTGAGCCTGGAGGTG
TTCCGGCATTCCGTGAGGGCCCTGCTGCAGAGAGTCAGCCCGGAGCCTCCCCCGGCCCCA
CGCCTCACCTACGAGTACTCCTGGTCCCTGGGCTGCGGCGTGGGGGCCGGCCTGATCCTG
CTGTTGGGGGCCGGCTGCTTTCTGCTGCTCACACTGCCTTCCTGGCCCTGGGGGTCCCTC
TGTCCCAAGCGGGGGCACCGGGCCACCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:13625
Chromosome Location19
LocusNot Available
References
  1. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. 11170751
  2. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. 11738816
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334