You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 12C
Synonyms
  • LENG3
  • MBS85
  • Protein phosphatase 1 myosin-binding subunit of 85 kDa
  • Protein phosphatase 1 myosin-binding subunit p85
Gene NamePPP1R12C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009117|Protein phosphatase 1 regulatory subunit 12C
MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPFSRRF
GLLKTGSSGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSPKLP
EPSVLSEVTKPPPCLENSSPPSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPESEKPAQSLDPSRRPRVPGVE
NSDSPAQRAEAPDGQGPGPQAAREHRKVGKEWRGPAEGEEAEPADRSQESSTLEGGPSAR
RQRWQRDLNPEPEPESEEPDGGFRTLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
Number of residues782
Molecular Weight84880.195
Theoretical pINot Available
GO Classification
Components
  • cytoplasm
General FunctionNot Available
Specific FunctionRegulates myosin phosphatase activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9BZL4
UniProtKB Entry NamePP12C_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013623|Protein phosphatase 1 regulatory subunit 12C (PPP1R12C)
ATGTCCGGAGAGGATGGCCCGGCGGCTGGCCCGGGGGCGGCGGCGGCGGCTGCCCGGGAG
CGGCGACGGGAGCAGCTGCGGCAGTGGGGGGCGCGGGCGGGCGCCGAGCCTGGCCCCGGA
GAGCGCCGCGCCCGCACCGTCCGCTTCGAGCGCGCCGCCGAGTTCCTGGCGGCCTGTGCG
GGCGGCGACCTGGACGAGGCGCGTCTGATGCTGCGCGCCGCCGACCCTGGCCCCGGCGCC
GAGCTCGACCCCGCCGCGCCGCCGCCCGCCCGCGCCGTGCTGGACTCCACCAACGCCGAC
GGTATCAGCGCCCTGCACCAGGCCTGCATTGATGAGAACCTGGAGGTGGTGCGCTTCTTG
GTGGAGCAGGGCGCCACTGTGAACCAGGCAGACAACGAGGGCTGGACGCCACTGCACGTG
GCCGCCTCCTGTGGCTACCTAGATATCGCCAGGTACCTCCTGAGCCACGGGGCCAACATC
GCCGCCGTCAACAGTGACGGGGACCTGCCCCTGGACCTGGCCGAGTCGGACGCCATGGAG
GGGCTGCTGAAGGCGGAGATCGCCCGCCGAGGTGTGGATGTGGAAGCAGCCAAGCGGGCA
GAAGAGGAATTGCTCCTTCATGACACGAGGTGCTGGCTGAATGGGGGCGCCATGCCAGAG
GCCCGGCACCCCCGCACAGGCGCCTCTGCCCTGCACGTGGCTGCTGCCAAGGGCTACATT
GAGGTGATGAGGTTGCTCCTTCAGGCTGGCTACGACCCAGAGCTCCGGGACGGGGACGGC
TGGACTCCCCTGCACGCAGCGGCACACTGGGGCGTGGAGGATGCCTGCCGCCTGCTGGCC
GAGCATGGCGGGGGCATGGACTCACTGACCCATGCGGGGCAGCGTCCCTGTGACCTGGCC
GATGAGGAAGTACTGAGCCTGTTGGAGGAACTGGCCCGGAAACAGGAGGACCTTCGGAAC
CAAAAAGAAGCTTCCCAGAGCCGGGGCCAGGAGCCCCAAGCGCCCTCTAGCAGCAAACAC
AGAAGGAGCTCTGTGTGTCGTCTGAGCAGTCGCGAGAAGATTTCCCTCCAGGACTTGTCC
AAGGAGCGCCGGCCTGGTGGGGCTGGGGGGCCCCCCATCCAGGACGAGGATGAGGGGGAA
GAAGGTCCCACCGAACCACCCCCTGCAGAACCCAGAACCCTCAATGGCGTCTCCTCCCCG
CCGCACCCCAGCCCTAAGAGTCCCGTGCTTGAAGAGGCCCCCTTCTCCAGGCGCTTTGGC
CTCCTGAAGACAGGGAGTTCTGGTGCCCTGGGTCCCCCTGAAAGGCGGACAGCGGAGGGA
GCCCCTGGGGCTGGGCTGCAGCGCTCGGCTTCCTCCTCCTGGCTGGAAGGGACCTCCACT
CAGGCCAAGGAGCTCCGTCTTGCCAGAATTACCCCGACCCCCTCCCCGAAGCTGCCGGAG
CCCTCTGTCCTGTCTGAGGTCACCAAGCCTCCTCCTTGCTTGGAGAACTCCTCGCCTCCC
TCCAGGATTCCGGAGCCTGAATCCCCAGCGAAGCCAAACGTCCCCACAGCCTCCACGGCG
CCCCCAGCGGACTCCCGGGACCGACGGAGGTCCTACCAGATGCCTGTGCGGGATGAGGAG
TCGGAATCCCAGAGAAAAGCTCGCTCCCGTCTCATGCGCCAGTCTCGGAGGTCCACACAG
GGTGTGACTCTTACAGACCTGAAGGAGGCAGAGAAGGCTGCAGGGAAGGCCCCAGAGTCA
GAGAAGCCGGCGCAGAGCCTGGACCCTTCCCGAAGGCCCCGCGTCCCTGGAGTGGAGAAC
TCTGACAGCCCTGCCCAGAGAGAGGCGCCCGACGGGCAGGGTCCGGGACCGCAGGCGGCC
AGGGAGCACCGCAAGGTCGGAAAGGAGTGGAGGGGGCCTGCGGAGGGGGAGGAGGCGGAG
CCGGCTGACCGCAGCCAGGAGTCCAGCACCCTGGAGGGCGGCCCCTCGGCCCGCAGGCAG
CGGTGGCAGCGGGACCTCAACCCAGAACCTGAGCCAGAATCGGAAGAGCCAGACGGAGGC
TTTAGGACGCTGTATGCAGAGCTGCGCAGGGAGAACGAGCGGCTTCGCGAGGCCCTGACC
GAGACCACGCTGCGGCTGGCGCAGCTCAAGGTGGAGCTGGAGCGGGCCACGCAGAGGCAA
GAACGCTTCGCTGAGAGGCCAGCCCTCCTGGAACTGGAGAGATTCGAGCGCAGGGCCCTG
GAACGCAAGGCCGCAGAGCTGGAGGAGGAGCTGAAGGCCCTGTCTGACCTCCGCGCTGAC
AACCAGCGCCTCAAGGATGAGAATGCAGCGTTGATCCGCGTCATCAGCAAACTCTCCAAG
TGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14947
Chromosome Location19
LocusNot Available
References
  1. Tan I, Ng CH, Lim L, Leung T: Phosphorylation of a novel myosin binding subunit of protein phosphatase 1 reveals a conserved mechanism in the regulation of actin cytoskeleton. J Biol Chem. 2001 Jun 15;276(24):21209-16. Epub 2001 Apr 3. 11399775
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Wende H, Volz A, Ziegler A: Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster. Immunogenetics. 2000 Jul;51(8-9):703-13. 10941842
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Bannert N, Vollhardt K, Asomuddinov B, Haag M, Konig H, Norley S, Kurth R: PDZ Domain-mediated interaction of interleukin-16 precursor proteins with myosin phosphatase targeting subunits. J Biol Chem. 2003 Oct 24;278(43):42190-9. Epub 2003 Aug 14. 12923170
  8. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  10. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  11. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  12. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569