You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit alpha-10
Synonyms
  • NACHR alpha-10
  • NACHRA10
  • Nicotinic acetylcholine receptor subunit alpha-10
Gene NameCHRNA10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010285|Neuronal acetylcholine receptor subunit alpha-10
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLAIFFSMALVMSLLVLVQAL
Number of residues450
Molecular Weight49704.295
Theoretical pI7.97
GO Classification
Functions
  • acetylcholine-activated cation-selective channel activity
  • calcium channel activity
  • receptor binding
Processes
  • detection of mechanical stimulus involved in sensory perception of sound
  • inner ear morphogenesis
  • positive regulation of cytosolic calcium ion concentration
  • regulation of cell proliferation
  • synaptic transmission, cholinergic
  • neuromuscular synaptic transmission
  • response to nicotine
  • regulation of membrane potential
  • signal transduction
  • cation transmembrane transport
  • neurological system process
Components
  • cell junction
  • cytosol
  • synapse
  • neuron projection
  • perikaryon
  • membrane
  • axon
  • postsynaptic membrane
  • acetylcholine-gated channel complex
General FunctionReceptor binding
Specific FunctionIonotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma.
Pfam Domain Function
Transmembrane Regions238-258 268-288 302-322 429-449
GenBank Protein ID12053839
UniProtKB IDQ9GZZ6
UniProtKB Entry NameACH10_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0010286|Neuronal acetylcholine receptor subunit alpha-10 (CHRNA10)
ATGCCGGCGCGGCGGCGCGTGCTCACCTACGGCTGCTGCTCCGAGCCCTACCCCGACGTC
ACCTTCACGCTGCTGCTGCGCCGCCGCGCCGCCGCCTACGTGTGCAACCTGCTGCTGCCC
TGCGTGCTCATCTCGCTGCTTGCGCCGCTCGCCTTCCACCTGCCTGCCGACTCAGGCGAG
AAGGTGTCGCTGGGCGTCACCGTGCTGCTGGCGCTCACCGTCTTCCAGTTGCTGCTGGCC
GAGAGCATGCCACCGGCCGAGAGCGTGCCGCTCATCGGGAAGTACTACATGGCCACTATG
ACCATGGTCACATTCTCAACAGCACTCACCATCCTTATCATGAACCTGCATTACTGTGGT
CCCAGTGTCCGCCCAGTGCCAGCCTGGGCTAGGGCCCTCCTGCTGGGACACCTGGCACGG
GGCCTGTGCGTGCGGGAAAGAGGGGAGCCCTGTGGGCAGTCCAGGCCACCTGAGTTATCT
CCTAGCCCCCAGTCGCCTGAAGGAGGGGCTGGCCCCCCAGCGGGCCCTTGCCACGAGCCA
CGATGTCTGTGCCGCCAGGAAGCCCTACTGCACCACGTAGCCACCATTGCCAATACCTTC
CGCAGCCACCGAGCTGCCCAGCGCTGCCATGAGGACTGGAAGCGCCTGGCCCGTGTGATG
GACCGCTTCTTCCTGGCCATCTTCTTCTCCATGGCCCTGGTCATGAGCCTCCTGGTGCTG
GTGCAGGCCCTGTGA
GenBank Gene IDAJ278118
GeneCard IDNot Available
GenAtlas IDCHRNA10
HGNC IDHGNC:13800
Chromosome Location11
Locus11p15.5
References
  1. Sgard F, Charpantier E, Bertrand S, Walker N, Caput D, Graham D, Bertrand D, Besnard F: A novel human nicotinic receptor subunit, alpha10, that confers functionality to the alpha9-subunit. Mol Pharmacol. 2002 Jan;61(1):150-9. 11752216
  2. Lustig LR, Peng H, Hiel H, Yamamoto T, Fuchs PA: Molecular cloning and mapping of the human nicotinic acetylcholine receptor alpha10 (CHRNA10). Genomics. 2001 May 1;73(3):272-83. 11350119
  3. Peng H, Ferris RL, Matthews T, Hiel H, Lopez-Albaitero A, Lustig LR: Characterization of the human nicotinic acetylcholine receptor subunit alpha (alpha) 9 (CHRNA9) and alpha (alpha) 10 (CHRNA10) in lymphocytes. Life Sci. 2004 Dec 3;76(3):263-80. 15531379