Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium voltage-gated channel subfamily H member 6
Synonyms
  • Eag-related protein 2
  • ERG-2
  • ERG2
  • Ether-a-go-go-related gene potassium channel 2
  • Ether-a-go-go-related protein 2
  • hERG-2
  • hERG2
  • Voltage-gated potassium channel subunit Kv11.2
Gene NameKCNH6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000923|Potassium voltage-gated channel subfamily H member 6
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
Number of residues994
Molecular Weight109923.705
Theoretical pI7.0
GO Classification
Functions
  • voltage-gated potassium channel activity
Processes
  • potassium ion transmembrane transport
  • regulation of membrane potential
  • synaptic transmission
Components
  • integral component of plasma membrane
  • plasma membrane
General FunctionVoltage-gated potassium channel activity
Specific FunctionPore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current (By similarity). Channel properties may be modulated by cAMP and subunit assembly.
Pfam Domain Function
Transmembrane Regions262-282 299-319 341-361 371-391 399-419 491-511
GenBank Protein ID11878259
UniProtKB IDQ9H252
UniProtKB Entry NameKCNH6_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0020467|Potassium voltage-gated channel subfamily H member 6 (KCNH6)
ATGCCGGTCCGCAGGGGCCACGTCGCTCCCCAAAACACTTACCTGGACACCATCATCCGC
AAGTTCGAGGGCCAAAGTCGGAAGTTCCTGATTGCCAATGCTCAGATGGAGAACTGCGCC
ATCATTTACTGCAACGACGGCTTCTGCGAACTCTTCGGCTACTCCCGAGTGGAGGTGATG
CAGCAACCCTGCACCTGCGACTTCCTCACAGGCCCCAACACACCAAGCAGCGCCGTGTCC
CGCCTAGCGCAGGCCCTGCTGGGGGCTGAGGAGTGCAAGGTGGACATCCTCTACTACCGC
AAGGATGCCTCCAGCTTCCGCTGCCTGGTAGATGTGGTGCCCGTGAAGAACGAGGACGGG
GCTGTCATCATGTTCATTCTCAACTTCGAGGACCTGGCCCAGCTCCTGGCCAAGTGCAGC
AGCCGCAGCTTGTCCCAGCGCCTGTTGTCCCAGAGCTTCCTGGGCTCCGAGGGCTCTCAT
GGCAGGCCAGGCGGACCAGGGCCAGGCACAGGCAGGGGCAAGTACAGGACCATCAGCCAG
ATCCCACAGTTCACGCTCAACTTCGTGGAGTTCAACTTGGAGAAGCACCGCTCCAGCTCC
ACCACGGAGATTGAGATCATCGCGCCCCATAAGGTGGTGGAGCGGACACAGAACGTCACT
GAGAAGGTCACCCAGGTCCTGTCCCTGGGCGCGGATGTGCTGCCGGAGTACAAGCTGCAG
GCGCCGCGCATCCACCGCTGGACCATCCTGCACTACAGCCCCTTCAAGGCCGTGTGGGAC
TGGCTCATCCTGCTGCTGGTCATCTACACGGCTGTCTTCACGCCCTACTCAGCCGCCTTC
CTGCTCAGCGATCAGGACGAATCACGGCGTGGGGCCTGCAGCTATACCTGCAGTCCCCTC
ACTGTGGTGGATCTCATCGTGGACATCATGTTCGTCGTGGACATCGTCATCAACTTCCGC
ACCACCTATGTCAACACCAATGATGAGGTGGTCAGCCACCCCCGCCGCATCGCCGTCCAC
TACTTCAAGGGCTGGTTCCTCATTGACATGGTGGCCGCCATCCCTTTCGACCTCCTGATC
TTCCGCACTGGCTCCGATGAGACCACAACCCTGATTGGGCTATTGAAGACAGCGCGGCTG
CTGCGGCTGGTGCGCGTAGCACGGAAGCTGGACCGCTACTCTGAGTATGGGGCGGCTGTG
CTCTTCTTGCTCATGTGCACCTTCGCGCTCATAGCGCACTGGCTGGCCTGCATCTGGTAC
GCCATCGGCAATGTGGAGCGGCCCTACCTAGAACACAAGATCGGCTGGCTGGACAGCCTG
GGTGTGCAGCTTGGCAAGCGCTACAACGGCAGCGACCCAGCCTCGGGCCCCTCGGTGCAG
GACAAGTATGTCACAGCCCTCTACTTCACCTTCAGCAGCCTCACCAGCGTGGGCTTCGGC
AATGTCTCGCCCAACACCAACTCCGAGAAGGTCTTCTCCATCTGCGTCATGCTCATCGGC
TCCCTGATGTACGCCAGCATCTTCGGGAACGTGTCCGCGATCATCCAGCGCCTGTACTCG
GGCACCGCGCGCTACCACACGCAGATGCTGCGTGTCAAGGAGTTCATCCGCTTCCACCAG
ATCCCCAACCCACTGCGCCAGCGCCTGGAGGAGTATTTCCAGCACGCCTGGTCCTACACC
AATGGCATTGACATGAACGCGGTGCTGAAGGGCTTCCCCGAGTGCCTGCAGGCTGACATC
TGCCTGCACCTGCACCGCGCACTGCTGCAGCACTGCCCAGCTTTCAGCGGCGCCGGCAAG
GGCTGCCTGCGCGCGCTAGCCGTCAAGTTCAAGACCACCCACGCGCCGCCTGGGGACACG
CTGGTGCACCTCGGCGACGTGCTCTCCACCCTCTACTTCATCTCCCGAGGCTCCATCGAG
ATCCTGCGCGACGACGTGGTCGTGGCCATCCTAGGAAAGAATGACATCTTTGGGGAACCC
GTCAGCCTCCATGCCCAGCCAGGCAAGTCCAGTGCAGACGTGCGGGCTCTGACCTACTGC
GACCTGCACAAGATCCAGCGGGCAGATCTGCTGGAGGTGCTGGACATGTACCCGGCCTTT
GCGGAGAGCTTCTGGAGTAAGCTGGAGGTCACCTTCAACCTGCGGGACGCAGCCGGGGGT
CTCCACTCATCCCCCCGACAGGCTCCTGGCAGCCAAGACCACCAAGGTTTCTTTCTCAGT
GACAACCAGTCAGATGCAGCCCCTCCCCTGAGCATCTCAGATGCATCTGGCCTCTGGCCT
GAGCTACTGCAGGAAATGCCCCCAAGGCACAGCCCCCAAAGCCCTCAGGAAGACCCAGAT
TGCTGGCCTCTGAAGCTGGGCTCCAGGCTAGAGCAGCTCCAGGCCCAGATGAACAGGCTG
GAGTCCCGCGTGTCCTCAGACCTCAGCCGCATCTTGCAGCTCCTCCAGAAGCCCATGCCC
CAGGGCCACGCCAGCTACATTCTGGAAGCCCCTGCCTCCAATGACCTGGCCTTGGTTCCT
ATAGCCTCGGAGACGACGAGTCCAGGGCCCAGGCTGCCCCAGGGCTTTCTGCCTCCTGCA
CAGACCCCAAGCTATGGAGACTTGGATGACTGTAGTCCAAAGCACAGGAACTCCTCCCCC
AGGATGCCTCACCTGGCTGTGGCAACGGACAAAACTCTGGCACCATCCTCAGAACAGGAA
CAGCCTGAGGGGCTCTGGCCACCCCTAGCCTCACCTCTACATCCCCTGGAAGTACAAGGA
CTCATCTGTGGTCCCTGCTTCTCCTCCCTCCCTGAACACCTTGGCTCTGTTCCCAAGCAG
CTGGACTTCCAGAGACATGGCTCAGATCCTGGATTTGCAGGGAGTTGGGGCCACTGA
GenBank Gene IDAF311913
GeneCard IDNot Available
GenAtlas IDKCNH6
HGNC IDHGNC:18862
Chromosome Location17
Locus17q23.3
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Bauer CK, Wulfsen I, Schafer R, Glassmeier G, Wimmers S, Flitsch J, Ludecke DK, Schwarz JR: HERG K(+) currents in human prolactin-secreting adenoma cells. Pflugers Arch. 2003 Feb;445(5):589-600. Epub 2002 Dec 6. 12634931
  4. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490