You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific demethylase 4C
Synonyms
  • 1.14.11.-
  • GASC-1 protein
  • GASC1
  • Gene amplified in squamous cell carcinoma 1 protein
  • JHDM3C
  • JmjC domain-containing histone demethylation protein 3C
  • JMJD2C
  • Jumonji domain-containing protein 2C
  • KIAA0780
Gene NameKDM4C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009324|Lysine-specific demethylase 4C
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Number of residues1056
Molecular Weight119980.795
Theoretical pINot Available
GO Classification
Functions
  • dioxygenase activity
  • histone demethylase activity (H3-K9 specific)
  • histone demethylase activity
  • zinc ion binding
  • enzyme binding
  • androgen receptor binding
Processes
  • histone H3-K9 demethylation
  • small GTPase mediated signal transduction
  • positive regulation of cell proliferation
  • transcription, DNA-templated
  • regulation of transcription from RNA polymerase II promoter
  • chromatin organization
Components
  • nucleoplasm
  • nuclear chromatin
General FunctionZinc ion binding
Specific FunctionHistone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9H3R0
UniProtKB Entry NameKDM4C_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0020886|Lysine-specific demethylase 4C (KDM4C)
ATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGA
CCCTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGA
GCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGC
TATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAG
TCAGGACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGG
CAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAG
CGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGG
AGCATATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGGAT
GTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTT
GGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAAT
TATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAACGA
CTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTT
CGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGAC
AAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTGGT
TTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGAC
TATGGAAAAGTTGCCAAATTGTGCACTTGCAGGAAAGACATGGTGAAGATTTCAATGGAT
ATCTTTGTGAGGAAATTTCAGCCAGACAGATATCAGCTTTGGAAACAAGGAAAGGATATA
TACACCATTGATCACACGAAGCCTACTCCAGCATCCACCCCTGAAGTAAAAGCATGGCTG
CAGAGGAGGAGGAAAGTAAGAAAAGCATCCCGAAGCTTCCAGTGTGCTAGGTCTACCTCT
AAAAGGCCTAAGGCTGATGAGGAAGAGGAAGTGTCAGATGAAGTCGATGGGGCAGAGGTC
CCTAACCCCGACTCAGTCACAGATGACCTCAAGGTCAGTGAAAAGTCAGAAGCAGCAGTG
AAGCTGAGGAACACAGAAGCATCTTCAGAAGAAGAGTCATCTGCTAGCAGGATGCAGGTG
GAGCAGAATTTATCAGATCATATCAAACTCTCAGGAAACAGCTGCTTAAGTACATCTGTA
ACAGAAGACATAAAAACTGAGGATGACAAAGCTTATGCATATAGAAGTGTACCTTCTATA
TCCAGTGAGGCTGATGATTCCATTCCATTGTCTAGTGGCTATGAGAAGCCCGAGAAATCA
GACCCATCCGAGCTTTCATGGCCAAAGTCACCTGAGTCATGCTCATCAGTGGCAGAGAGT
AATGGTGTGTTAACAGAGGGAGAAGAGAGTGATGTGGAGAGCCATGGGAATGGCCTTGAA
CCTGGGGAAATCCCAGCGGTCCCCAGTGGAGAGAGAAATAGCTTCAAAGTCCCCAGTATA
GCAGAGGGAGAGAACAAAACCTCTAAGAGTTGGCGCCATCCACTTAGCAGGCCTCCAGCA
AGATCTCCGATGACTCTTGTGAAGCAGCAGGCGCCAAGTGATGAAGAATTGCCTGAGGTT
CTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGGCGAAACCTCTCATCCACCTT
TGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGG
ATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGC
AATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATGAAGTCGTTACATCGGAGGGA
AAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATAT
TCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAG
TGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTTCTCATGAGATCTGTGATGGA
TGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTG
AGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTT
GCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGACACAAATAGATGTAGGCAGA
ATACCTTTACAGAGGTTAAAATTGGGAAGGCTGGGAATCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:17071
Chromosome Location9
LocusNot Available
References
  1. Yang ZQ, Imoto I, Fukuda Y, Pimkhaokham A, Shimada Y, Imamura M, Sugano S, Nakamura Y, Inazawa J: Identification of a novel gene, GASC1, within an amplicon at 9p23-24 frequently detected in esophageal cancer cell lines. Cancer Res. 2000 Sep 1;60(17):4735-9. 10987278
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. 9872452
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y: Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases. Cell. 2006 May 5;125(3):467-81. Epub 2006 Apr 6. 16603238
  7. Hillringhaus L, Yue WW, Rose NR, Ng SS, Gileadi C, Loenarz C, Bello SH, Bray JE, Schofield CJ, Oppermann U: Structural and evolutionary basis for the dual substrate selectivity of human KDM4 histone demethylase family. J Biol Chem. 2011 Dec 2;286(48):41616-25. doi: 10.1074/jbc.M111.283689. Epub 2011 Sep 13. 21914792