You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 23
Synonyms
  • 3.1.3.48
  • HD-PTP
  • His domain-containing protein tyrosine phosphatase
  • KIAA1471
  • Protein tyrosine phosphatase TD14
  • PTP-TD14
Gene NamePTPN23
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009000|Tyrosine-protein phosphatase non-receptor type 23
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQ
LMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQA
GAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAAL
PTPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKK
LFEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVA
SYEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRP
TAPKPLLPRREESEAVEAGDPPEELRSLPPDMVAGPRLPDTFLGSATPLHFPPSPFPSST
GPGPHYLSGPLPPGTYSGPTQLIQPRAPGPHAMPVAPGPALYPAPAYTPELGLVPRSSPQ
HGVVSSPYVGVGPAPPVAGLPSAPPPQFSGPELAMAVRPATTTVDSIQAPIPSHTAPRPN
PTPAPPPPCFPVPPPQPLPTPYTYPAGAKQPIPAQHHFSSGIPAGFPAPRIGPQPQPHPQ
PHPSQAFGPQPPQQPLPLQHPHLFPPQAPGLLPPQSPYPYAPQPGVLGQPPPPLHTQLYP
GPAQDPLPAHSGALPFPSPGPPQPPHPPLAYGPAPSTRPMGPQAAPLTIRGPSSAGQSTP
SPHLVPSPAPSPGPGPVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGGTQSPGGGQPL
LQPTKVDAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQD
AQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLV
ATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLAL
SSVRSTETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLH
QRPLHTPIIVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKL
HLRFCYEAVVRHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQA
TIAKLSIRPPGGLESPVASLPGPAEPPGLPPASLPESTPIPSSSPPPLSSPLPEAPQPKE
EPPVPEAPSSGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKHNFLQAHNGQGLRATRPS
DDPLSLLDPLWTLNKT
Number of residues1636
Molecular Weight178971.945
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • protein kinase binding
Processes
  • peptidyl-tyrosine dephosphorylation
  • cilium morphogenesis
  • negative regulation of epithelial cell migration
  • positive regulation of adherens junction organization
  • positive regulation of early endosome to late endosome transport
  • positive regulation of homophilic cell adhesion
  • ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
  • protein transport
Components
  • extracellular exosome
  • nucleoplasm
  • endosome
  • cytoplasmic membrane-bounded vesicle
  • early endosome
  • ciliary basal body
  • cytoplasm
  • nucleus
General FunctionProtein tyrosine phosphatase activity
Specific FunctionPlays a role in sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) via its interaction with the ESCRT-I complex (endosomal sorting complex required for transport I), and possibly also other ESCRT complexes. May act as a negative regulator of Ras-mediated mitogenic activity. Plays a role in ciliogenesis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9H3S7
UniProtKB Entry NamePTN23_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013557|Tyrosine-protein phosphatase non-receptor type 23 (PTPN23)
ATGCTGGGGGCCATGGACAAGCGGGTGTCTGAGGAGGGCATGAAGGTCTCCTGTACCCAT
TTCCAGTGCGCAGCCGGCGCCTTCGCCTACCTACGGGAGCACTTCCCTCAAGCCTACAGC
GTCGACATGAGCCGCCAGATCCTTACGCTCAACGTCAACCTCATGCTGGGCCAGGCTCAG
GAGTGCCTCCTGGAGAAGTCGATGTTGGACAACAGGAAGAGCTTTCTGGTGGCCCGCATC
AGTGCACAGGTGGTAGATTACTACAAGGAGGCATGCCGGGCCTTGGAGAACCCCGACACT
GCCTCACTGCTGGGCCGGATCCAGAAGGACTGGAAGAAACTTGTGCAGATGAAGATCTAC
TACTTCGCAGCCGTGGCTCATCTGCACATGGGAAAGCAGGCCGAGGAGCAGCAGAAGTTC
GGGGAGCGGGTTGCATACTTCCAGAGCGCCCTGGACAAGCTCAATGAAGCCATCAAGTTG
GCCAAGGGCCAGCCTGACACTGTGCAAGACGCGCTTCGCTTCACTATGGATGTCATTGGG
GGAAAGTACAATTCTGCCAAGAAGGACAACGACTTCATTTACCATGAGGCTGTCCCAGCA
TTGGACACTCTTCAGCCTGTAAAAGGAGCCCCCTTGGTGAAGCCCTTGCCAGTGAACCCC
ACAGACCCAGCTGTTACAGGCCCTGACATCTTTGCCAAACTGGTACCCATGGCTGCCCAC
GAGGCCTCGTCACTGTACAGTGAGGAGAAGGCCAAGCTGCTCCGGGAGATGATGGCCAAG
ATTGAGGACAAGAATGAGGTCCTGGACCAGTTCATGGATTCAATGCAGTTGGATCCCGAG
ACGGTGGACAACCTTGATGCCTACAGCCACATCCCACCCCAGCTCATGGAGAAGTGCGCG
GCTCTCAGCGTCCGGCCCGACACTGTCAGGAACCTTGTACAGTCCATGCAAGTGCTGTCA
GGTGTGTTCACGGATGTGGAGGCTTCCCTGAAGGACATCAGAGATCTGTTGGAGGAGGAT
GAGCTGCTAGAGCAGAAGTTTCAGGAGGCGGTGGGCCAGGCAGGGGCCATCTCCATCACC
TCCAAGGCTGAGCTGGCAGAGGTGAGGCGAGAATGGGCCAAGTACATGGAAGTCCATGAG
AAGGCCTCCTTCACCAACAGTGAGCTGCACCGTGCCATGAACCTGCACGTCGGCAACCTG
CGCCTGCTCAGCGGGCCGCTTGACCAGGTCCGGGCTGCCCTGCCCACACCGGCCCTCTCC
CCAGAGGACAAGGCCGTGCTGCAAAACCTAAAGCGCATCCTGGCTAAGGTGCAGGAGATG
CGGGACCAGCGCGTGTCCCTGGAGCAGCAGCTGCGTGAGCTTATCCAGAAAGATGACATC
ACTGCCTCGCTGGTCACCACAGACCACTCAGAGATGAAGAAGTTGTTCGAGGAGCAGCTG
AAAAAGTATGACCAGCTGAAGGTGTACCTGGAGCAGAACCTGGCCGCCCAGGACCGTGTC
CTCTGTGCACTGACAGAGGCCAACGTGCAGTACGCAGCCGTGCGGCGGGTACTCAGCGAC
TTGGACCAAAAGTGGAACTCCACGCTGCAGACCCTGGTGGCCTCGTATGAAGCCTATGAG
GACCTGATGAAGAAGTCGCAGGAGGGCAGGGACTTCTACGCAGATCTGGAGAGCAAGGTG
GCTGCTCTGCTGGAGCGCACGCAGTCCACCTGCCAGGCCCGCGAGGCTGCCCGCCAGCAG
CTCCTGGACAGGGAGCTGAAGAAGAAGCCGCCGCCACGGCCCACAGCCCCAAAGCCGCTG
CTGCCCCGCAGGGAGGAGAGTGAGGCAGTGGAAGCAGGAGACCCCCCTGAGGAGCTGCGC
AGCCTCCCCCCTGACATGGTGGCTGGCCCACGACTGCCTGACACCTTCCTGGGAAGTGCC
ACCCCGCTCCACTTTCCTCCCAGCCCCTTCCCCAGCTCCACAGGCCCAGGACCCCACTAT
CTCTCAGGCCCCTTGCCCCCTGGTACCTACTCGGGCCCCACCCAGCTGATACAGCCCAGG
GCCCCAGGGCCCCATGCAATGCCCGTAGCACCTGGGCCTGCCCTCTACCCAGCCCCTGCC
TACACACCGGAGCTGGGCCTTGTGCCCCGATCCTCCCCACAGCATGGCGTGGTGAGCAGT
CCCTATGTGGGGGTAGGGCCGGCCCCACCAGTTGCAGGTCTCCCCTCGGCCCCACCTCCT
CAATTCTCAGGCCCCGAGTTGGCCATGGCGGTTCGGCCAGCCACCACCACAGTAGATAGC
ATCCAGGCGCCCATCCCCAGCCACACAGCCCCACGGCCAAACCCCACCCCTGCTCCTCCC
CCGCCCTGCTTCCCTGTGCCCCCACCGCAGCCACTGCCCACGCCTTACACCTACCCTGCA
GGGGCTAAGCAACCCATCCCGGCACAGCACCACTTCTCTTCTGGGATCCCCGCAGGTTTT
CCAGCCCCAAGGATTGGGCCCCAGCCCCAGCCCCATCCTCAGCCCCATCCTTCACAAGCG
TTTGGGCCTCAGCCCCCACAGCAGCCCCTTCCACTCCAGCATCCACATCTCTTCCCACCC
CAGGCCCCAGGACTCCTACCCCCACAATCCCCCTACCCCTATGCCCCTCAGCCTGGGGTC
CTGGGGCAGCCGCCACCCCCCCTACACACCCAGCTCTACCCAGGTCCCGCTCAAGACCCT
CTGCCAGCCCACTCAGGGGCTCTGCCTTTCCCCAGCCCTGGGCCCCCTCAGCCTCCCCAT
CCCCCACTGGCATATGGTCCTGCCCCTTCTACCAGACCCATGGGCCCCCAGGCAGCCCCT
CTTACCATTCGAGGGCCCTCGTCTGCTGGCCAGTCCACCCCTAGTCCCCACCTGGTGCCT
TCACCTGCCCCATCTCCAGGGCCTGGTCCGGTACCCCCTCGCCCCCCAGCAGCAGAACCA
CCCCCTTGCCTGCGCCGAGGCGCCGCAGCTGCAGACCTGCTCTCCTCCAGCCCGGAGAGC
CAGCATGGCGGCACTCAGTCTCCTGGGGGTGGGCAGCCCCTGCTGCAGCCCACCAAGGTG
GATGCAGCTGAGGGTCGTCGGCCGCAGGCCCTGCGGCTGATTGAGCGGGACCCCTATGAG
CATCCTGAGAGGCTGCGGCAGTTGCAGCAGGAGCTGGAGGCCTTTCGGGGTCAGCTGGGG
GATGTGGGAGCTCTGGACACTGTCTGGCGAGAGCTGCAAGATGCGCAGGAACATGATGCC
CGAGGCCGTTCCATCGCCATTGCCCGCTGCTACTCACTGAAGAACCGGCACCAGGATGTC
ATGCCCTATGACAGTAACCGTGTGGTGCTGCGCTCAGGCAAGGATGACTACATCAATGCC
AGCTGCGTGGAGGGGCTCTCCCCATACTGCCCCCCGCTAGTGGCAACCCAGGCCCCACTG
CCTGGCACAGCTGCTGACTTCTGGCTCATGGTCCATGAGCAGAAAGTGTCAGTCATTGTC
ATGCTGGTTTCTGAGGCTGAGATGGAGAAGCAAAAAGTGGCACGCTACTTCCCCACCGAG
AGGGGCCAGCCCATGGTGCACGGTGCCCTGAGCCTGGCATTGAGCAGCGTCCGCAGCACC
GAAACCCATGTGGAGCGCGTGCTGAGCCTGCAGTTCCGAGACCAGAGCCTCAAGCGCTCT
CTTGTGCACCTGCACTTCCCCACTTGGCCTGAGTTAGGCCTGCCCGACAGCCCCAGCAAC
TTGCTGCGCTTCATCCAGGAGGTGCACGCACATTACCTGCATCAGCGGCCGCTGCACACG
CCCATCATTGTGCACTGCAGCTCTGGTGTGGGCCGCACGGGAGCCTTTGCACTGCTCTAT
GCAGCTGTGCAGGAGGTGGAGGCTGGGAACGGAATCCCTGAGCTGCCTCAGCTGGTGCGG
CGCATGCGGCAGCAGAGAAAGCACATGCTGCAGGAGAAGCTGCACCTCAGGTTCTGCTAT
GAGGCAGTGGTGAGACACGTGGAGCAGGTCCTGCAGCGCCATGGTGTGCCTCCTCCATGC
AAACCCTTGGCCAGTGCAAGCATCAGCCAGAAGAACCACCTTCCTCAGGACTCCCAGGAC
CTGGTCCTCGGTGGGGATGTGCCCATCAGCTCCATCCAGGCCACCATTGCCAAGCTCAGC
ATTCGGCCTCCTGGGGGGTTGGAGTCCCCGGTTGCCAGCTTGCCAGGCCCTGCAGAGCCC
CCAGGCCTCCCGCCAGCCAGCCTCCCAGAGTCTACCCCAATCCCATCTTCCTCCCCGCCC
CCCCTTTCCTCCCCACTACCTGAGGCTCCCCAGCCTAAGGAGGAGCCGCCAGTGCCTGAA
GCCCCCAGCTCGGGGCCCCCCTCCTCCTCCCTGGAATTGCTGGCCTCCTTGACCCCAGAG
GCCTTCTCCCTGGACAGCTCCCTGCGGGGCAAACAGCGGATGAGCAAGCATAACTTTCTG
CAGGCCCATAACGGGCAAGGGCTGCGGGCCACCCGGCCCTCTGACGACCCCCTCAGCCTT
CTGGATCCACTCTGGACACTCAACAAGACCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14406
Chromosome Location3
LocusNot Available
References
  1. Toyooka S, Ouchida M, Jitsumori Y, Tsukuda K, Sakai A, Nakamura A, Shimizu N, Shimizu K: HD-PTP: A novel protein tyrosine phosphatase gene on human chromosome 3p21.3. Biochem Biophys Res Commun. 2000 Nov 30;278(3):671-8. 11095967
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. 10819331
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  8. Doyotte A, Mironov A, McKenzie E, Woodman P: The Bro1-related protein HD-PTP/PTPN23 is required for endosomal cargo sorting and multivesicular body morphogenesis. Proc Natl Acad Sci U S A. 2008 Apr 29;105(17):6308-13. doi: 10.1073/pnas.0707601105. Epub 2008 Apr 23. 18434552
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  10. Kim J, Lee JE, Heynen-Genel S, Suyama E, Ono K, Lee K, Ideker T, Aza-Blanc P, Gleeson JG: Functional genomic screen for modulators of ciliogenesis and cilium length. Nature. 2010 Apr 15;464(7291):1048-51. doi: 10.1038/nature08895. 20393563
  11. Tanase CA: Histidine domain-protein tyrosine phosphatase interacts with Grb2 and GrpL. PLoS One. 2010 Dec 15;5(12):e14339. doi: 10.1371/journal.pone.0014339. 21179510
  12. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  13. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  14. Stefani F, Zhang L, Taylor S, Donovan J, Rollinson S, Doyotte A, Brownhill K, Bennion J, Pickering-Brown S, Woodman P: UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting. Curr Biol. 2011 Jul 26;21(14):1245-50. doi: 10.1016/j.cub.2011.06.028. Epub 2011 Jul 14. 21757351
  15. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  16. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  17. Sette P, Mu R, Dussupt V, Jiang J, Snyder G, Smith P, Xiao TS, Bouamr F: The Phe105 loop of Alix Bro1 domain plays a key role in HIV-1 release. Structure. 2011 Oct 12;19(10):1485-95. doi: 10.1016/j.str.2011.07.016. Epub 2011 Sep 1. 21889351