You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 3E
SynonymsNot Available
Gene NamePPP1R3E
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009132|Protein phosphatase 1 regulatory subunit 3E
MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEPGEGGTRFGARSRAHAPSR
GRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIQL
QRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSARV
VDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLFALRY
RVTGHEFWDNNGGRDYALRGPEHPGSGGAPEPQGWIHFI
Number of residues279
Molecular Weight30643.2
Theoretical pINot Available
GO Classification
Functions
  • phosphoprotein phosphatase activity
Processes
  • glycogen metabolic process
  • regulation of glycogen biosynthetic process
  • regulation of glycogen catabolic process
Components
  • glycogen granule
General FunctionPhosphoprotein phosphatase activity
Specific FunctionActs as a glycogen-targeting subunit for PP1. PP1 is involved in glycogen metabolism and contributes to the activation of glycogen synthase leading to an increase in glycogen synthesis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9H7J1
UniProtKB Entry NamePPR3E_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0019728|Protein phosphatase 1 regulatory subunit 3E (PPP1R3E)
ATGTCCCGTGAGCGGCCCCCGGGCACCGACATTCCCCGCAACCTGAGCTTCATCGCCGCG
CTAACGGAGCGCGCCTACTACCGTAGCCAGCGGCCCAGCCTCGAGGAGGAGCCGGAGGAG
GAGCCAGGCGAGGGCGGGACGCGGTTCGGGGCCCGATCCCGCGCTCACGCACCGAGTCGG
GGCCGCCGGGCCCGATCTGCACCAGCCGGAGGCGGCGGGGCCCGGGCGCCCCGCAGCCGT
AGCCCAGACACCCGCAAGAGAGTGCGTTTCGCCGACGCACTGGGGTTGGAGCTGGCTGTC
GTGCGCCGCTTCCGTCCCGGTGAGCTGCCCCGGGTGCCCCGCCACGTGCAGATCCAATTG
CAGAGGGACGCCCTCCGCCACTTCGCGCCCTGCCAGCCCCGCGCCCGCGGCCTCCAGGAG
GCGCGCGCCGCCCTGGAGCCGGCCAGCGAGCCCGGCTTCGCCGCCCGCTTGCTGACGCAG
CGCATCTGCCTGGAACGCGCCGAGGCGGGCCCGCTGGGCGTGGCCGGGAGCGCGCGCGTG
GTGGACCTGGCCTACGAGAAGCGCGTGAGCGTGCGCTGGAGCGCCGACGGCTGGCGGAGC
CAACGCGAGGCGCCAGCCGCCTACGCCGGTCCGGCCCCGCCCCCGCCGCGCGCCGACCGC
TTCGCCTTCCGCCTGCCCGCGCCGCCGATTGGGGGCGCCCTGCTCTTCGCCTTGCGCTAC
CGTGTGACAGGTCACGAGTTCTGGGACAACAACGGCGGCCGTGACTATGCTCTACGTGGG
CCCGAGCACCCGGGCAGTGGCGGAGCTCCGGAGCCGCAGGGCTGGATCCACTTTATCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14943
Chromosome Location14
LocusNot Available
References
  1. Munro S, Ceulemans H, Bollen M, Diplexcito J, Cohen PT: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents. FEBS J. 2005 Mar;272(6):1478-89. 15752363
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569