Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePutative tubulin-like protein alpha-4B
Synonyms
  • Alpha-tubulin 4B
  • TUBA4
Gene NameTUBA4B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012380|Putative tubulin-like protein alpha-4B
MRHQQTERQDPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDR
IRKLADQCTGLQGFLVFHSLGRGTGSDVTSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAM
VQPYNSILTTHTTLEHSDCAFMVDNKAIYDICHCNLDIERPTYTNLNRLISQIVSSITAS
LRFDGALNVDLTEFQTNLVSYLTSTSPWPPMHQSSLQKRYTTSSCWWQRLPMPALSLPTR
W
Number of residues241
Molecular Weight27551.01
Theoretical pI8.59
GO Classification
Functions
  • GTP binding
  • GTPase activity
  • structural constituent of cytoskeleton
Processes
  • microtubule-based process
Components
  • cytoplasm
  • microtubule
General FunctionStructural constituent of cytoskeleton
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9H853
UniProtKB Entry NameTBA4B_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0006630|726 bp
ATGCGGCACCAGCAGACAGAGAGACAAGACCCCAGCCAGCCCCTGTCCAGGCAGCATGGC
ACATACCGCCAGATCTTCCATCCAGAGCAGCTCATCACAGGCAAGGAAGATGCTGCCAAT
AACTATGCCTGGGGCCACTACACCATTGGGAAGGAGTTCATCGACCTGCTACTGGACCGG
ATTCGGAAGCTGGCTGACCAGTGCACAGGACTTCAGGGCTTCCTGGTGTTCCACAGCCTT
GGTCGGGGCACTGGCTCTGACGTCACCTCATTCCTGATGGAGTGGCTTTCTGTTAACTAT
GGCAAGAAATCCAAGCTGGGATTCTCCATCTACCCAGCCCCCCAGGTGTCTACAGCCATG
GTCCAGCCCTACAACTCTATCCTGACCACCCACACCACCCTGGAGCACTCAGACTGTGCC
TTCATGGTGGACAACAAAGCAATCTATGACATCTGCCACCGCAACCTAGACATTGAGCGC
CCAACCTACACCAACCTCAATCGCCTCATTAGCCAAATTGTCTCCTCCATCACAGCTTCT
CTGCGCTTTGACGGGGCCCTCAATGTGGACCTGACAGAGTTCCAGACCAACCTGGTGTCC
TACCTCACATCCACTTCCCCCTGGCCACCTATGCACCAGTCATCTCTGCAGAAAAAGTAT
ACCACGAGCAGCTGTCGGTGGCAGAGATTACCAATGCCTGCTTTGAGCCTGCCAACCAGA
TGGTGA
GenBank Gene IDAK024002
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:18637
Chromosome LocationNot Available
LocusNot Available
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621