You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMitochondrial glutamate carrier 1
Synonyms
  • GC-1
  • GC1
  • Glutamate/H(+) symporter 1
  • Solute carrier family 25 member 22
Gene NameSLC25A22
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004468|Mitochondrial glutamate carrier 1
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA
Number of residues323
Molecular Weight34469.85
Theoretical pI9.67
GO Classification
Functions
  • symporter activity
  • L-glutamate transmembrane transporter activity
Processes
  • L-glutamate transmembrane transport
  • L-glutamate transport
Components
  • mitochondrion
  • mitochondrial inner membrane
  • integral component of membrane
  • nucleoplasm
General FunctionSymporter activity
Specific FunctionInvolved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+).
Pfam Domain Function
Transmembrane Regions12-32 62-82 107-127 189-209 223-243 292-312
GenBank Protein ID21322705
UniProtKB IDQ9H936
UniProtKB Entry NameGHC1_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0016737|Mitochondrial glutamate carrier 1 (SLC25A22)
ATGGCTGATAAGCAGATCAGCCTGCCAGCCAAGCTCATCAATGGCGGCATCGCCGGGCTG
ATCGGTGTCACCTGCGTGTTTCCCATCGACCTGGCCAAGACCAGGCTGCAGAACCAGCAG
AACGGCCAGCGCGTGTACACGAGCATGTCCGACTGCCTCATCAAGACCGTCCGCTCCGAG
GGCTACTTCGGCATGTACCGGGGAGCTGCTGTGAACTTGACCCTCGTCACCCCCGAGAAG
GCCATCAAGCTGGCAGCCAACGACTTCTTCCGACATCAGCTCTCTAAGGACGGGCAGAAG
CTGACCCTGCTTAAAGAGATGCTGGCGGGCTGTGGGGCTGGCACCTGCCAGGTGATCGTG
ACCACGCCCATGGAGATGCTGAAGATCCAGCTGCAGGATGCAGGGCGCATTGCCGCCCAG
AGGAAGATCCTGGCTGCCCAGGGCCAGCTCTCGGCCCAGGGGGGTGCCCAGCCCTCAGTG
GAGGCTCCAGCTGCCCCTCGGCCCACGGCCACCCAGCTGACCCGCGACCTGCTGCGGAGC
CGTGGCATTGCCGGTCTCTACAAGGGACTCGGGGCCACGCTGCTCAGGGATGTCCCCTTC
TCTGTGGTGTACTTCCCGCTCTTTGCCAACCTGAACCAGCTGGGCCGCCCGGCGTCCGAG
GAGAAGTCGCCTTTCTACGTGTCCTTCCTGGCCGGCTGTGTGGCTGGGAGTGCCGCCGCT
GTGGCCGTCAACCCCTGTGATGTGGTGAAGACGCGGCTCCAGTCACTTCAGCGAGGCGTC
AACGAGGACACCTACTCTGGGATCCTGGACTGTGCCAGGAAGATCCTGCGGCACGAGGGC
CCCTCGGCCTTCCTGAAGGGCGCCTACTGCCGCGCGCTGGTCATCGCGCCCCTTTTCGGC
ATCGCACAGGTGGTCTACTTCCTGGGCATCGCGGAGTCCCTGCTGGGGCTGCTGCAGGAC
CCCCAGGCCTGA
GenBank Gene IDAJ428202
GeneCard IDNot Available
GenAtlas IDSLC25A22
HGNC IDHGNC:19954
Chromosome Location11
Locus11p15.5
References
  1. Fiermonte G, Palmieri L, Todisco S, Agrimi G, Palmieri F, Walker JE: Identification of the mitochondrial glutamate transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms. J Biol Chem. 2002 May 31;277(22):19289-94. Epub 2002 Mar 15. 11897791
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  7. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  8. Molinari F, Raas-Rothschild A, Rio M, Fiermonte G, Encha-Razavi F, Palmieri L, Palmieri F, Ben-Neriah Z, Kadhom N, Vekemans M, Attie-Bitach T, Munnich A, Rustin P, Colleaux L: Impaired mitochondrial glutamate transport in autosomal recessive neonatal myoclonic epilepsy. Am J Hum Genet. 2005 Feb;76(2):334-9. Epub 2004 Dec 8. 15592994