Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 52, riboflavin transporter, member 2
Synonyms
  • GPR172A
  • hRFT3
  • PAR1
  • PERV-A receptor 1
  • Porcine endogenous retrovirus A receptor 1
  • Protein GPR172A
  • RFT3
  • Riboflavin transporter 3
Gene NameSLC52A2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013324|Solute carrier family 52, riboflavin transporter, member 2
MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
GLLVVTLWRRLAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFV
LALACCASNVTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGT
PGPPLDFLERFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGA
EEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLS
PCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA
VAMFPPTSIYHVFHSRKDCADPCDS
Number of residues445
Molecular Weight45776.61
Theoretical pINot Available
GO Classification
Functions
  • virus receptor activity
  • riboflavin transporter activity
Processes
  • riboflavin transport
Components
  • integral component of plasma membrane
General FunctionVirus receptor activity
Specific FunctionRiboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
Pfam Domain Function
Transmembrane Regions14-34 47-67 86-106 112-132 147-167 196-216 277-297 312-332 339-359 366-386 404-424
GenBank Protein IDNot Available
UniProtKB IDQ9HAB3
UniProtKB Entry NameS52A2_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013325|Solute carrier family 52, riboflavin transporter, member 2 (SLC52A2)
ATGGCAGCACCCACGCCCGCCCGTCCGGTGCTGACCCACCTGCTGGTGGCTCTCTTCGGC
ATGGGCTCCTGGGCTGCGGTCAATGGGATCTGGGTGGAGCTACCTGTGGTGGTCAAAGAG
CTTCCAGAGGGTTGGAGCCTCCCCTCTTACGTCTCTGTGCTTGTGGCTCTGGGGAACCTG
GGTCTGCTGGTGGTGACCCTCTGGAGGAGGCTGGCCCCAGGAAAGGACGAGCAGGTCCCC
ATCCGGGTGGTGCAGGTGCTGGGCATGGTGGGCACAGCCCTGCTGGCCTCTCTGTGGCAC
CATGTGGCCCCAGTGGCAGGACAGTTGCATTCTGTGGCCTTCTTAGCACTGGCCTTTGTG
CTGGCACTGGCATGCTGTGCCTCGAATGTCACTTTCCTGCCCTTCTTGAGCCACCTGCCA
CCTCGCTTCTTACGGTCATTCTTCCTGGGTCAAGGCCTGAGTGCCCTGCTGCCCTGCGTG
CTGGCCCTAGTGCAGGGTGTGGGCCGCCTCGAGTGCCCGCCAGCCCCCATCAACGGCACC
CCTGGCCCCCCGCTCGACTTCCTTGAGCGTTTTCCCGCCAGCACCTTCTTCTGGGCACTG
ACTGCCCTTCTGGTCGCTTCAGCTGCTGCCTTCCAGGGTCTTCTGCTGCTGTTGCCGCCA
CCACCATCTGTACCCACAGGGGAGTTAGGATCAGGCCTCCAGGTGGGAGCCCCAGGAGCA
GAGGAAGAGGTGGAAGAGTCCTCACCACTGCAAGAGCCACCAAGCCAGGCAGCAGGCACC
ACCCCTGGTCCAGACCCTAAGGCCTATCAGCTTCTATCAGCCCGCAGTGCCTGCCTGCTG
GGCCTGTTGGCCGCCACCAACGCGCTGACCAATGGCGTGCTGCCTGCCGTGCAGAGCTTT
TCCTGCTTACCCTACGGGCGTCTGGCCTACCACCTGGCTGTGGTGCTGGGCAGTGCTGCC
AATCCCCTGGCCTGCTTCCTGGCCATGGGTGTGCTGTGCAGGTCCTTGGCAGGGCTGGGC
GGCCTCTCTCTGCTGGGCGTGTTCTGTGGGGGCTACCTGATGGCGCTGGCAGTCCTGAGC
CCCTGCCCGCCCCTGGTGGGCACCTCGGCGGGGGTGGTCCTCGTGGTGCTGTCGTGGGTG
CTGTGTCTTGGCGTGTTCTCCTACGTGAAGGTGGCAGCCAGCTCCCTGCTGCATGGCGGG
GGCCGGCCGGCATTGCTGGCAGCCGGCGTGGCCATCCAGGTGGGCTCTCTGCTCGGCGCT
GTTGCTATGTTCCCCCCGACCAGCATCTATCACGTGTTCCACAGCAGAAAGGACTGTGCA
GACCCCTGTGACTCCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:30224
Chromosome Location8
LocusNot Available
References
  1. Ericsson TA, Takeuchi Y, Templin C, Quinn G, Farhadian SF, Wood JC, Oldmixon BA, Suling KM, Ishii JK, Kitagawa Y, Miyazawa T, Salomon DR, Weiss RA, Patience C: Identification of receptors for pig endogenous retrovirus. Proc Natl Acad Sci U S A. 2003 May 27;100(11):6759-64. Epub 2003 May 9. 12740431
  2. Yao Y, Yonezawa A, Yoshimatsu H, Masuda S, Katsura T, Inui K: Identification and comparative functional characterization of a new human riboflavin transporter hRFT3 expressed in the brain. J Nutr. 2010 Jul;140(7):1220-6. doi: 10.3945/jn.110.122911. Epub 2010 May 12. 20463145
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Mazari PM, Linder-Basso D, Sarangi A, Chang Y, Roth MJ: Single-round selection yields a unique retroviral envelope utilizing GPR172A as its host receptor. Proc Natl Acad Sci U S A. 2009 Apr 7;106(14):5848-53. doi: 10.1073/pnas.0809741106. Epub 2009 Mar 23. 19307586
  7. Johnson JO, Gibbs JR, Megarbane A, Urtizberea JA, Hernandez DG, Foley AR, Arepalli S, Pandraud A, Simon-Sanchez J, Clayton P, Reilly MM, Muntoni F, Abramzon Y, Houlden H, Singleton AB: Exome sequencing reveals riboflavin transporter mutations as a cause of motor neuron disease. Brain. 2012 Sep;135(Pt 9):2875-82. doi: 10.1093/brain/aws161. Epub 2012 Jun 26. 22740598