You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier organic anion transporter family member 1B3
Synonyms
  • Liver-specific organic anion transporter 2
  • LST-2
  • LST2
  • OATP-8
  • OATP1B3
  • OATP8
  • Organic anion transporter 8
  • Organic anion-transporting polypeptide 8
  • SLC21A8
  • Solute carrier family 21 member 8
Gene NameSLCO1B3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0007032|Solute carrier organic anion transporter family member 1B3
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
Number of residues702
Molecular Weight77402.175
Theoretical pI8.95
GO Classification
Functions
  • organic anion transmembrane transporter activity
  • sodium-independent organic anion transmembrane transporter activity
  • bile acid transmembrane transporter activity
Processes
  • sodium-independent organic anion transport
  • organic anion transport
  • small molecule metabolic process
  • anion transmembrane transport
  • transmembrane transport
  • bile acid metabolic process
  • bile acid and bile salt transport
Components
  • plasma membrane
  • integral component of plasma membrane
  • basolateral plasma membrane
General FunctionSodium-independent organic anion transmembrane transporter activity
Specific FunctionMediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP). Involved in the clearance of bile acids and organic anions from the liver.
Pfam Domain Function
Transmembrane Regions29-48 68-88 95-119 169-197 217-237 256-280 332-353 374-397 402-425 538-560 570-595 630-647
GenBank Protein ID9187497
UniProtKB IDQ9NPD5
UniProtKB Entry NameSO1B3_HUMAN
Cellular LocationBasolateral cell membrane
Gene sequence
>lcl|BSEQ0012544|Solute carrier organic anion transporter family member 1B3 (SLCO1B3)
ATGGACCAACATCAACATTTGAATAAAACAGCAGAGTCAGCATCTTCAGAGAAAAAGAAA
ACAAGACGCTGCAATGGATTCAAGATGTTCTTGGCAGCCCTGTCATTCAGCTATATTGCT
AAAGCACTAGGTGGAATCATTATGAAAATTTCCATCACTCAAATAGAAAGGAGATTTGAC
ATATCCTCTTCTCTTGCTGGTTTAATTGATGGAAGCTTTGAAATTGGAAATTTGCTTGTG
ATTGTATTTGTAAGTTACTTTGGATCTAAACTACACAGACCGAAGTTAATTGGAATTGGT
TGTCTCCTTATGGGAACTGGAAGTATTTTGACATCTTTACCACATTTCTTCATGGGATAT
TATAGGTATTCTAAAGAAACCCATATTAATCCATCAGAAAATTCAACATCAAGTTTATCA
ACCTGTTTAATTAATCAAACCTTATCATTCAATGGAACATCACCTGAGATAGTAGAAAAA
GATTGTGTAAAGGAATCTGGGTCACACATGTGGATCTATGTCTTCATGGGGAATATGCTT
CGTGGCATAGGGGAAACCCCCATAGTACCATTGGGGATTTCATACATTGATGATTTTGCA
AAAGAAGGACATTCTTCCTTGTATTTAGGTAGTTTGAATGCAATAGGAATGATTGGTCCA
GTCATTGGCTTTGCACTGGGATCTCTGTTTGCTAAAATGTACGTGGATATTGGATATGTA
GATCTGAGCACTATCAGAATAACTCCTAAGGACTCTCGTTGGGTTGGAGCTTGGTGGCTT
GGTTTCCTTGTGTCTGGACTATTTTCCATTATTTCTTCCATACCATTTTTTTTCTTGCCG
AAAAATCCAAATAAACCACAAAAAGAAAGAAAAATTTCACTATCATTGCATGTGCTGAAA
ACAAATGATGATAGAAATCAAACAGCTAATTTGACCAACCAAGGAAAAAATGTTACCAAA
AATGTGACTGGTTTTTTCCAGTCTTTGAAAAGCATCCTTACCAATCCCCTGTATGTTATA
TTTCTGCTTTTGACATTGTTACAAGTAAGCAGCTTTATTGGTTCTTTTACTTACGTCTTT
AAATATATGGAGCAACAGTACGGTCAGTCTGCATCTCATGCTAACTTTTTGTTGGGAATC
ATAACCATTCCTACGGTTGCAACTGGAATGTTTTTAGGAGGATTTATCATTAAAAAATTC
AAATTGTCTTTAGTTGGAATTGCCAAATTTTCATTTCTTACTTCGATGATATCCTTCTTG
TTTCAACTTCTATATTTCCCTCTAATCTGCGAAAGCAAATCAGTTGCCGGCCTAACCTTG
ACCTATGATGGAAATAATTCAGTGGCATCTCATGTAGATGTACCACTTTCTTATTGCAAC
TCAGAGTGCAATTGTGATGAAAGTCAGTGGGAACCAGTCTGTGGGAACAATGGAATAACT
TACCTGTCACCTTGTCTAGCAGGATGCAAATCCTCAAGTGGTATTAAAAAGCATACAGTG
TTTTATAACTGTAGTTGTGTGGAAGTAACTGGTCTCCAGAACAGAAATTACTCAGCACAC
TTGGGTGAATGCCCAAGAGATAATACTTGTACAAGGAAATTTTTCATCTATGTTGCAATT
CAAGTCATAAACTCTTTGTTCTCTGCAACAGGAGGTACCACATTTATCTTGTTGACTGTG
AAGATTGTTCAACCTGAATTGAAAGCACTTGCAATGGGTTTCCAGTCAATGGTTATAAGA
ACACTAGGAGGAATTCTAGCTCCAATATATTTTGGGGCTCTGATTGATAAAACATGTATG
AAGTGGTCCACCAACAGCTGTGGAGCACAAGGAGCTTGTAGGATATATAATTCCGTATTT
TTTGGAAGGGTCTACTTGGGCTTATCTATAGCTTTAAGATTCCCAGCACTTGTTTTATAT
ATTGTTTTCATTTTTGCTATGAAGAAAAAATTTCAAGGAAAAGATACCAAGGCATCGGAC
AATGAAAGAAAAGTAATGGATGAAGCAAACTTAGAATTCTTAAATAATGGTGAACATTTT
GTACCTTCTGCTGGAACAGATAGTAAAACATGTAATTTGGACATGCAAGACAATGCTGCT
GCCAACTAA
GenBank Gene IDAJ251506
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10961
Chromosome Location12
Locus12p12
References
  1. Konig J, Cui Y, Nies AT, Keppler D: Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide. J Biol Chem. 2000 Jul 28;275(30):23161-8. 10779507
  2. Abe T, Unno M, Onogawa T, Tokui T, Kondo TN, Nakagomi R, Adachi H, Fujiwara K, Okabe M, Suzuki T, Nunoki K, Sato E, Kakyo M, Nishio T, Sugita J, Asano N, Tanemoto M, Seki M, Date F, Ono K, Kondo Y, Shiiba K, Suzuki M, Ohtani H, Shimosegawa T, Iinuma K, Nagura H, Ito S, Matsuno S: LST-2, a human liver-specific organic anion transporter, determines methotrexate sensitivity in gastrointestinal cancers. Gastroenterology. 2001 Jun;120(7):1689-99. 11375950
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075
  4. van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH: Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver. J Clin Invest. 2012 Feb;122(2):519-28. doi: 10.1172/JCI59526. Epub 2012 Jan 9. 22232210
  5. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974