Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium voltage-gated channel subfamily H member 7
Synonyms
  • Eag-related protein 3
  • ERG-3
  • ERG3
  • Ether-a-go-go-related gene potassium channel 3
  • Ether-a-go-go-related protein 3
  • hERG-3
  • Voltage-gated potassium channel subunit Kv11.3
Gene NameKCNH7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037062|Potassium voltage-gated channel subfamily H member 7
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK
Number of residues1196
Molecular Weight134998.525
Theoretical pI7.77
GO Classification
Functions
  • voltage-gated potassium channel activity
  • inward rectifier potassium channel activity
Processes
  • synaptic transmission
  • circadian rhythm
  • potassium ion transmembrane transport
  • protein heterooligomerization
  • regulation of membrane potential
Components
  • integral component of plasma membrane
  • plasma membrane
General FunctionVoltage-gated potassium channel activity
Specific FunctionPore-forming (alpha) subunit of voltage-gated potassium channel. Channel properties may be modulated by cAMP and subunit assembly.
Pfam Domain Function
Transmembrane Regions413-433 450-470 495-515 522-542 550-570 642-662
GenBank Protein ID4104136
UniProtKB IDQ9NS40
UniProtKB Entry NameKCNH7_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0010490|Potassium voltage-gated channel subfamily H member 7 (KCNH7)
ATGCCTGTGCGCAGGGGGCATGTGGCACCACAAAATACATTTCTGGGGACCATCATTCGG
AAATTTGAAGGGCAAAATAAAAAATTTATCATTGCAAATGCCAGAGTGCAGAACTGTGCC
ATCATTTATTGCAACGATGGGTTCTGTGAGATGACTGGTTTCTCCAGGCCAGATGTCATG
CAAAAGCCATGCACCTGCGACTTTCTCCATGGACCCGAGACCAAGAGGCATGATATTGCC
CAAATTGCCCAGGCATTGCTGGGGTCAGAAGAGAGGAAAGTGGAGGTCACCTACTATCAC
AAAAATGGGTCCACTTTTATTTGTAACACTCACATAATTCCAGTGAAAAACCAAGAGGGC
GTGGCTATGATGTTCATCATTAATTTTGAATATGTGACGGATAATGAAAACGCTGCCACC
CCAGAGAGGGTAAACCCAATATTACCAATCAAAACTGTAAACCGGAAATTTTTTGGGTTC
AAATTCCCTGGTCTGAGAGTTCTCACTTACAGAAAGCAGTCCTTACCACAAGAAGACCCC
GATGTGGTGGTCATCGATTCATCTAAACACAGTGATGATTCAGTAGCCATGAAGCATTTT
AAGTCTCCTACAAAAGAAAGCTGCAGCCCCTCTGAAGCAGATGACACAAAAGCTTTGATA
CAGCCCAGCAAATGTTCTCCCTTGGTGAATATATCCGGACCTCTTGACCATTCCTCTCCC
AAAAGGCAATGGGACCGACTCTACCCTGACATGCTGCAGTCAAGTTCCCAGCTGTCCCAT
TCCAGATCAAGGGAAAGCTTATGTAGTATACGGAGAGCATCTTCGGTCCATGATATAGAA
GGATTCGGCGTCCACCCCAAGAACATATTTAGAGACCGACATGCCAGCGAAGACAATGGT
CGCAATGTCAAAGGGCCTTTTAATCATATCAAGTCAAGCCTCCTGGGATCCACATCAGAT
TCAAACCTCAACAAATACAGCACCATTAACAAGATTCCACAGCTCACTCTGAATTTTTCA
GAGGTCAAAACTGAGAAAAAGAATTCATCACCTCCTTCTTCAGATAAAACCATTATTGCA
CCCAAGGTTAAAGATCGAACACACAATGTGACTGAGAAAGTGACCCAGGTTCTCTCTTTA
GGAGCAGATGTCCTACCTGAATACAAACTGCAGACACCACGCATCAACAAGTTTACGATA
TTGCACTACAGCCCTTTCAAGGCAGTCTGGGACTGGCTTATCCTGCTGTTGGTCATATAC
ACTGCTATATTTACTCCCTACTCTGCAGCCTTCCTCCTCAATGACAGAGAAGAACAGAAA
AGACGAGAATGTGGCTATTCTTGTAGCCCTTTGAATGTGGTAGACTTGATTGTGGATATT
ATGTTTATCATAGATATTTTAATAAACTTCAGAACAACATATGTAAATCAGAATGAAGAA
GTGGTAAGTGATCCCGCCAAAATAGCAATACACTACTTCAAAGGCTGGTTCCTGATTGAC
ATGGTTGCAGCAATTCCTTTTGACTTGCTGATTTTTGGATCAGGTTCTGATGAGACAACA
ACATTAATTGGTCTTTTGAAGACTGCCCGACTCCTCCGTCTTGTGCGCGTGGCCAGGAAA
CTGGATCGATATTCAGAATATGGCGCTGCTGTTCTAATGCTCTTAATGTGCATCTTTGCC
CTGATTGCTCACTGGCTGGCTTGCATTTGGTATGCGATTGGGAATGTAGAAAGGCCTTAC
CTGACTGACAAAATCGGATGGTTGGATTCCTTAGGACAGCAAATTGGGAAACGTTACAAT
GACAGTGACTCAAGTTCTGGACCATCCATTAAAGACAAATACGTCACAGCACTTTATTTT
ACCTTCAGCAGTTTAACCAGTGTAGGATTCGGGAATGTGTCTCCTAACACGAATTCGGAG
AAAATCTTTTCAATTTGTGTCATGTTGATTGGCTCACTAATGTATGCAAGCATTTTTGGG
AATGTATCTGCAATTATCCAAAGACTATACTCGGGAACTGCCAGGTACCACATGCAGATG
CTGCGAGTAAAAGAGTTCATTCGCTTTCACCAAATCCCCAACCCTCTGAGGCAACGTCTT
GAAGAATATTTCCAGCACGCATGGACTTACACCAATGGCATTGACATGAACATGGTCCTA
AAGGGTTTCCCAGAATGCTTACAAGCAGACATTTGTCTACATCTCAACCAGACATTGCTG
CAAAACTGCAAAGCCTTTCGGGGGGCAAGTAAAGGTTGCCTTAGAGCTTTGGCAATGAAG
TTCAAAACCACCCATGCACCTCCAGGAGACACCCTCGTTCACTGTGGGGATGTCCTCACT
GCACTTTATTTCTTATCCAGAGGCTCCATTGAAATTCTCAAAGATGACATTGTGGTGGCT
ATTCTGGGAAAAAATGATATATTTGGAGAAATGGTTCATCTTTATGCCAAACCTGGAAAG
TCTAATGCAGATGTAAGAGCCCTCACATACTGTGACTTGCATAAGATTCAGCGAGAAGAC
TTGTTAGAGGTTTTGGATATGTATCCTGAGTTTTCTGATCACTTTCTAACAAACCTAGAG
TTGACTTTCAACCTAAGGCATGAGAGCGCAAAGGCTGATCTCCTACGATCACAATCCATG
AATGATTCAGAAGGAGACAACTGTAAACTAAGAAGAAGGAAATTGTCATTTGAAAGTGAA
GGAGAGAAAGAAAACAGTACAAATGATCCTGAAGACTCTGCAGATACCATAAGACATTAT
CAGAGTTCCAAGAGACACTTTGAAGAGAAAAAAAGCAGATCCTCATCTTTCATCTCCTCC
ATTGATGATGAACAAAAGCCGCTCTTCTCAGGAATAGTAGACTCTTCTCCAGGAATAGGG
AAAGCATCTGGGCTCGATTTTGAAGAAACAGTGCCCACCTCAGGAAGAATGCACATAGAT
AAAAGAAGTCACTCTTGCAAAGATATCACTGACATGCGAAGCTGGGAACGAGAAAATGCA
CATCCCCAGCCTGAAGACTCCAGTCCATCTGCACTTCAGCGAGCTGCCTGGGGTATCTCT
GAAACCGAAAGCGACCTCACCTACGGGGAAGTGGAACAAAGATTAGATCTGCTCCAGGAG
CAACTTAACAGGCTTGAATCCCAAATGACCACTGACATCCAGACCATCTTACAGTTGCTG
CAGAAACAAACCACTGTGGTCCCCCCAGCCTACAGTATGGTAACAGCAGGATCAGAATAT
CAGAGACCCATCATCCAGCTGATGAGAACCAGTCAACCGGAAGCATCCATCAAAACTGAC
CGAAGTTTCAGCCCTTCCTCACAATGTCCTGAATTTCTAGACCTTGAAAAATCTAAACTT
AAATCCAAAGAATCCCTTTCAAGTGGGGTGCATCTGAACACAGCTTCAGAAGACAACTTG
ACTTCACTTTTAAAACAAGACAGTGATCTCTCTTTAGAGCTTCACCTGCGGCAAAGAAAA
ACTTACGTTCATCCAATTAGGCATCCTTCTTTGCCAGATTCATCCCTAAGCACTGTAGGA
ATCGTGGGTCTTCATAGGCATGTTTCTGATCCTGGTCTTCCAGGGAAATAA
GenBank Gene IDAF032897
GeneCard IDNot Available
GenAtlas IDKCNH7
HGNC IDHGNC:18863
Chromosome Location2
Locus2q24.2
References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Bauer CK, Wulfsen I, Schafer R, Glassmeier G, Wimmers S, Flitsch J, Ludecke DK, Schwarz JR: HERG K(+) currents in human prolactin-secreting adenoma cells. Pflugers Arch. 2003 Feb;445(5):589-600. Epub 2002 Dec 6. 12634931