You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 22 member 11
Synonyms
  • OAT4
  • Organic anion transporter 4
Gene NameSLC22A11
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001752|Solute carrier family 22 member 11
MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
EAVTVESTSL
Number of residues550
Molecular Weight59970.945
Theoretical pI8.71
GO Classification
Functions
  • inorganic anion exchanger activity
  • organic anion transmembrane transporter activity
  • sodium-independent organic anion transmembrane transporter activity
Processes
  • organic anion transport
  • anion transmembrane transport
  • transmembrane transport
  • sodium-independent organic anion transport
  • urate metabolic process
Components
  • plasma membrane
  • extracellular exosome
  • external side of plasma membrane
  • integral component of plasma membrane
  • apical plasma membrane
General FunctionSodium-independent organic anion transmembrane transporter activity
Specific FunctionMediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds.
Pfam Domain Function
Transmembrane Regions11-31 143-163 175-195 201-221 232-252 257-277 347-367 379-399 403-423 431-451 464-484 491-511
GenBank Protein ID7707622
UniProtKB IDQ9NSA0
UniProtKB Entry NameS22AB_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010620|Solute carrier family 22 member 11 (SLC22A11)
ATGGCGTTCTCGAAGCTCTTGGAGCAAGCCGGAGGCGTGGGCCTCTTCCAGACCCTGCAG
GTGCTCACCTTCATCCTCCCCTGCCTCATGATACCTTCCCAGATGCTCCTGGAGAACTTC
TCAGCCGCCATCCCAGGCCACCGATGCTGGACACACATGCTGGACAATGGCTCTGCGGTT
TCCACAAACATGACCCCCAAGGCCCTTCTGACCATCTCCATCCCGCCAGGCCCCAACCAG
GGGCCCCACCAGTGCCGCCGCTTCCGCCAGCCACAGTGGCAGCTCTTGGACCCCAATGCC
ACGGCCACCAGCTGGAGCGAAGCTGACACGGAGCCGTGTGTGGACGGCTGGGTCTATGAC
CGCAGCGTCTTCACCTCCACCATCGTGGCCAAGTGGGACCTGGTGTGCAGCTCCCAGGGC
TTGAAGCCCCTAAGCCAGTCCATCTTCATGTCCGGGATCCTGGTGGGCTCCTTTATCTGG
GGCCTCCTCTCCTACCGGTTTGGGAGGAAGCCGATGCTGAGCTGGTGCTGCCTGCAGTTG
GCCGTGGCGGGCACCAGCACCATCTTCGCCCCAACATTCGTCATCTACTGCGGCCTGCGG
TTCGTGGCCGCTTTTGGGATGGCCGGCATCTTTCTGAGTTCACTGACACTGATGGTGGAG
TGGACCACGACCAGCAGGAGGGCGGTCACCATGACGGTGGTGGGATGTGCCTTCAGCGCA
GGCCAGGCGGCGCTGGGCGGCCTGGCCTTTGCCCTGCGGGACTGGAGGACTCTCCAGCTG
GCAGCATCAGTGCCCTTCTTTGCCATCTCCCTGATATCCTGGTGGCTGCCAGAATCCGCC
CGGTGGCTGATTATTAAGGGCAAACCAGACCAAGCACTTCAGGAGCTCAGAAAGGTGGCC
AGGATAAATGGCCACAAGGAGGCCAAGAACCTGACCATAGAGGTGCTGATGTCCAGCGTG
AAGGAGGAGGTGGCCTCTGCAAAGGAGCCGCGGTCGGTGCTGGACCTGTTCTGCGTGCCC
GTGCTCCGCTGGAGGAGCTGCGCCATGCTGGTGGTGAAGATGACAGCAGATGGCATTCTG
CATACAGTGGGCCGGCTGGGGGCTATGATGGGTCCCCTGATCCTGATGAGCCGCCAAGCC
CTGCCCCTGCTGCCTCCTCTCCTCTATGGCGTTATCTCCATTGCTTCCAGCCTGGTTGTG
CTGTTCTTCCTCCCGGAGACCCAGGGACTTCCGCTCCCTGACACTATCCAGGACCTGGAG
AGCCAGAAATCAACAGCAGCCCAGGGCAACCGGCAAGAGGCCGTCACTGTGGAAAGTACC
TCGCTCTAG
GenBank Gene IDAB026116
GeneCard IDNot Available
GenAtlas IDSLC22A11
HGNC IDHGNC:18120
Chromosome Location11
Locus11q13.1
References
  1. Cha SH, Sekine T, Kusuhara H, Yu E, Kim JY, Kim DK, Sugiyama Y, Kanai Y, Endou H: Molecular cloning and characterization of multispecific organic anion transporter 4 expressed in the placenta. J Biol Chem. 2000 Feb 11;275(6):4507-12. 10660625
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Zhou F, Pan Z, Ma J, You G: Mutational analysis of histidine residues in human organic anion transporter 4 (hOAT4). Biochem J. 2004 Nov 15;384(Pt 1):87-92. 15291761
  6. Zhou F, Tanaka K, Pan Z, Ma J, You G: The role of glycine residues in the function of human organic anion transporter 4. Mol Pharmacol. 2004 May;65(5):1141-7. 15102942
  7. Zhou F, Xu W, Hong M, Pan Z, Sinko PJ, Ma J, You G: The role of N-linked glycosylation in protein folding, membrane targeting, and substrate binding of human organic anion transporter hOAT4. Mol Pharmacol. 2005 Mar;67(3):868-76. Epub 2004 Dec 2. 15576633