Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSodium channel protein type 3 subunit alpha
Synonyms
  • KIAA1356
  • NAC3
  • Sodium channel protein brain III subunit alpha
  • Sodium channel protein type III subunit alpha
  • Voltage-gated sodium channel subtype III
  • Voltage-gated sodium channel subunit alpha Nav1.3
Gene NameSCN3A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004082|Sodium channel protein type 3 subunit alpha
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVSLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGP
SALTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
KMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKTCY
SIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWV
AYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDISDVNN
LSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEE
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLVLSR
INLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLF
RVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV
KKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSVKGD
CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKF
DPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRV
LGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRL
KNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEK
FEKDKPEKESKGKEVRENQK
Number of residues2000
Molecular Weight226291.905
Theoretical pI5.49
GO Classification
Functions
  • voltage-gated sodium channel activity
Processes
  • neuronal action potential
  • sodium ion transport
  • sodium ion transmembrane transport
  • membrane depolarization during action potential
Components
  • cytoplasm
  • voltage-gated sodium channel complex
  • plasma membrane
General FunctionVoltage-gated sodium channel activity
Specific FunctionMediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
Pfam Domain Function
Transmembrane Regions124-147 156-175 189-207 214-233 249-273 401-426 755-779 791-814 823-842 849-869 885-905 959-984 1202-1225 1239-1264 1271-1292 1297-1318 1338-1359 1442-1468 1522-1545 1557-1580 1587-1610 1621-1642 1658-1680 1747-1771
GenBank Protein ID7414320
UniProtKB IDQ9NY46
UniProtKB Entry NameSCN3A_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0011509|Sodium channel protein type 3 subunit alpha (SCN3A)
ATGGCACAGGCACTGTTGGTACCCCCAGGACCTGAAAGCTTCCGCCTTTTTACTAGAGAA
TCTCTTGCTGCTATCGAAAAACGTGCTGCAGAAGAGAAAGCCAAGAAGCCCAAAAAGGAA
CAAGATAATGATGATGAGAACAAACCAAAGCCAAATAGTGACTTGGAAGCTGGAAAGAAC
CTTCCATTTATTTATGGAGACATTCCTCCAGAGATGGTGTCAGAGCCCCTGGAGGACCTG
GATCCCTACTATATCAATAAGAAAACTTTTATAGTAATGAATAAAGGAAAGGCAATTTTC
CGATTCAGTGCCACCTCTGCCTTGTATATTTTAACTCCACTAAACCCTGTTAGGAAAATT
GCTATCAAGATTTTGGTACATTCTTTATTCAGCATGCTTATCATGTGCACTATTTTGACC
AACTGTGTATTTATGACCTTGAGCAACCCTCCTGACTGGACAAAGAATGTAGAGTACACA
TTCACTGGAATCTATACCTTTGAGTCACTTATAAAAATCTTGGCAAGAGGGTTTTGCTTA
GAAGATTTTACGTTTCTTCGTGATCCATGGAACTGGCTGGATTTCAGTGTCATTGTGATG
GCATATGTGACAGAGTTTGTGGACCTGGGCAATGTCTCAGCGTTGAGAACATTCAGAGTT
CTCCGAGCACTGAAAACAATTTCAGTCATTCCAGGTTTAAAGACCATTGTGGGGGCCCTG
ATCCAGTCGGTAAAGAAGCTTTCTGATGTGATGATCCTGACTGTGTTCTGTCTGAGCGTG
TTTGCTCTCATTGGGCTGCAGCTGTTCATGGGCAATCTGAGGAATAAATGTTTGCAGTGG
CCCCCAAGCGATTCTGCTTTTGAAACCAACACCACTTCCTACTTTAATGGCACAATGGAT
TCAAATGGGACATTTGTTAATGTAACAATGAGCACATTTAACTGGAAGGATTACATTGGA
GATGACAGTCACTTTTATGTTTTGGATGGGCAAAAAGACCCTTTACTCTGTGGAAATGGC
TCAGATGCAGGCCAGTGTCCAGAAGGATACATCTGTGTGAAGGCTGGTCGAAACCCCAAC
TATGGCTACACAAGCTTTGACACCTTTAGCTGGGCTTTCCTGTCTCTATTTCGACTCATG
ACTCAAGACTACTGGGAAAATCTTTACCAGTTGACATTACGTGCTGCTGGGAAAACATAC
ATGATATTTTTTGTCCTGGTCATTTTCTTGGGCTCATTTTATTTGGTGAATTTGATCCTG
GCTGTGGTGGCCATGGCCTATGAGGAGCAGAATCAGGCCACCTTGGAAGAAGCAGAACAA
AAAGAGGCCGAATTTCAGCAGATGCTCGAACAGCTTAAAAAGCAACAGGAAGAAGCTCAG
GCAGTTGCGGCAGCATCAGCTGCTTCAAGAGATTTCAGTGGAATAGGTGGGTTAGGAGAG
CTGTTGGAAAGTTCTTCAGAAGCATCAAAGTTGAGTTCCAAAAGTGCTAAAGAATGGAGG
AACCGAAGGAAGAAAAGAAGACAGAGAGAGCACCTTGAAGGAAACAACAAAGGAGAGAGA
GACAGCTTTCCCAAATCCGAATCTGAAGACAGCGTCAAAAGAAGCAGCTTCCTTTTCTCC
ATGGATGGAAACAGACTGACCAGTGACAAAAAATTCTGCTCCCCTCATCAGTCTCTCTTG
AGTATCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACAAGCATTTTCAGTTTC
AGAGGTCGGGCAAAGGATGTTGGATCTGAAAATGACTTTGCTGATGATGAACACAGCACA
TTTGAAGACAGCGAAAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACATGGAGAGCGA
CGCAACAGTAACGGCACCACCACAGAAACGGAAGTCAGAAAGAGAAGGTTAAGCTCTTAC
CAGATTTCAATGGAGATGCTGGAGGATTCCTCTGGAAGGCAAAGAGCCGTGAGCATAGCC
AGCATTCTGACCAACACAATGGAAGAACTTGAAGAATCTAGACAGAAATGTCCGCCATGC
TGGTATAGATTTGCCAATGTGTTCTTGATCTGGGACTGCTGTGATGCATGGTTAAAAGTA
AAACATCTTGTGAATTTAATTGTTATGGATCCATTTGTTGATCTTGCCATCACTATTTGC
ATTGTCTTAAATACCCTCTTTATGGCCATGGAGCACTACCCCATGACTGAGCAATTCAGT
AGTGTGTTGACTGTAGGAAACCTGGTCTTTACTGGGATTTTCACAGCAGAAATGGTTCTC
AAGATCATTGCCATGGATCCTTATTACTATTTCCAAGAAGGCTGGAATATCTTTGATGGA
ATTATTGTCAGCCTCAGTTTAATGGAGCTTGGTCTGTCAAATGTGGAGGGATTGTCTGTA
CTGCGATCATTCAGACTGCTTAGAGTTTTCAAGTTGGCAAAATCCTGGCCCACACTAAAT
ATGCTAATTAAGATCATTGGCAATTCTGTGGGGGCTCTAGGAAACCTCACCTTGGTGTTG
GCCATCATCGTCTTCATTTTTGCTGTGGTCGGCATGCAGCTCTTTGGTAAGAGCTACAAA
GAATGTGTCTGCAAGATCAATGATGACTGTACGCTCCCACGGTGGCACATGAACGACTTC
TTCCACTCCTTCCTGATTGTGTTCCGCGTGCTGTGTGGAGAGTGGATAGAGACCATGTGG
GACTGTATGGAGGTCGCTGGCCAAACCATGTGCCTTATTGTTTTCATGTTGGTCATGGTC
ATTGGAAACCTTGTGGTTCTGAACCTCTTTCTGGCCTTATTGTTGAGTTCATTTAGCTCA
GACAACCTTGCTGCTACTGATGATGACAATGAAATGAATAATCTGCAGATTGCAGTAGGA
AGAATGCAAAAGGGAATTGATTATGTGAAAAATAAGATGCGGGAGTGTTTCCAAAAAGCC
TTTTTTAGAAAGCCAAAAGTTATAGAAATCCATGAAGGCAATAAGATAGACAGCTGCATG
TCCAATAATACTGGAATTGAAATAAGCAAAGAGCTTAATTATCTTAGAGATGGGAATGGA
ACCACCAGTGGTGTAGGTACTGGAAGCAGTGTTGAAAAATACGTAATCGATGAAAATGAT
TATATGTCATTCATAAACAACCCCAGCCTCACCGTCACAGTGCCAATTGCTGTTGGAGAG
TCTGACTTTGAAAACTTAAATACTGAAGAGTTCAGCAGTGAGTCAGAACTAGAAGAAAGC
AAAGAGAAATTAAATGCAACCAGCTCATCTGAAGGAAGCACAGTTGATGTTGTTCTACCC
CGAGAAGGTGAACAAGCTGAAACTGAACCCGAAGAAGACCTTAAACCGGAAGCTTGTTTT
ACTGAAGGATGTATTAAAAAGTTTCCATTCTGTCAAGTAAGTACAGAAGAAGGCAAAGGG
AAGATCTGGTGGAATCTTCGAAAAACCTGCTACAGTATTGTTGAGCACAACTGGTTTGAG
ACTTTCATTGTGTTCATGATCCTTCTCAGTAGTGGTGCATTGGCCTTTGAAGATATATAC
ATTGAACAGCGAAAGACTATCAAAACCATGCTAGAATATGCTGACAAAGTCTTTACCTAT
ATATTCATTCTGGAAATGCTTCTCAAATGGGTTGCTTATGGATTTCAAACATATTTCACT
AATGCCTGGTGCTGGCTAGATTTCTTGATCGTTGATGTTTCTTTGGTTAGCCTGGTAGCC
AATGCTCTTGGCTACTCAGAACTCGGTGCCATCAAATCATTACGGACATTAAGAGCTTTA
AGACCTCTAAGAGCCTTATCCCGGTTTGAAGGCATGAGGGTGGTTGTGAATGCTCTTGTT
GGAGCAATTCCCTCTATCATGAATGTGCTGTTGGTCTGTCTCATCTTCTGGTTGATCTTT
AGCATCATGGGTGTGAATTTGTTTGCTGGCAAGTTCTACCACTGTGTTAACATGACAACG
GGTAACATGTTTGACATTAGTGATGTTAACAATTTGAGTGACTGTCAGGCTCTTGGCAAG
CAAGCTCGGTGGAAAAACGTGAAAGTAAACTTTGATAATGTTGGCGCTGGCTATCTTGCA
CTGCTTCAAGTGGCCACATTTAAAGGCTGGATGGATATTATGTATGCAGCTGTTGATTCA
CGAGATGTTAAACTTCAGCCTGTATATGAAGAAAATCTGTACATGTATTTATACTTTGTC
ATCTTTATCATCTTTGGGTCATTCTTCACTCTGAATCTATTCATTGGTGTCATCATAGAT
AACTTCAACCAGCAGAAAAAGAAGTTTGGAGGTCAAGACATCTTTATGACAGAGGAACAG
AAAAAATATTACAATGCAATGAAGAAACTTGGATCCAAGAAACCTCAGAAACCCATACCT
CGCCCAGCAAACAAATTCCAAGGAATGGTCTTTGATTTTGTAACCAGACAAGTCTTTGAT
ATCAGCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAAACGGATGAC
CAGGGCAAATACATGACCCTAGTTTTGTCCCGGATCAACCTAGTGTTCATTGTTCTGTTC
ACTGGAGAATTTGTGCTGAAGCTCGTCTCCCTCAGACACTACTACTTCACTATAGGCTGG
AACATCTTTGACTTTGTGGTGGTGATTCTCTCCATTGTAGGTATGTTTCTGGCTGAGATG
ATAGAAAAGTATTTTGTGTCCCCTACCTTGTTCCGAGTGATCCGTCTTGCCAGGATTGGC
CGAATCCTACGTCTGATCAAAGGAGCAAAGGGGATCCGCACGCTGCTCTTTGCTTTGATG
ATGTCCCTTCCTGCGTTGTTTAACATCGGCCTCCTGCTCTTCCTGGTCATGTTTATCTAT
GCCATCTTTGGGATGTCCAACTTTGCCTATGTTAAAAAGGAAGCTGGAATTGATGACATG
TTCAACTTTGAGACCTTTGGCAACAGCATGATCTGCTTGTTCCAAATTACAACCTCTGCT
GGCTGGGATGGATTGCTAGCACCTATTCTTAATAGTGCACCACCCGACTGTGACCCTGAC
ACAATTCACCCTGGCAGCTCAGTTAAGGGAGACTGTGGGAACCCATCTGTTGGGATTTTC
TTTTTTGTCAGTTACATCATCATATCCTTCCTGGTTGTGGTGAACATGTACATCGCGGTC
ATCCTGGAGAACTTCAGTGTTGCTACTGAAGAAAGTGCAGAGCCCCTGAGTGAGGATGAC
TTTGAGATGTTCTATGAGGTTTGGGAAAAGTTTGATCCCGATGCGACCCAGTTTATAGAG
TTCTCTAAACTCTCTGATTTTGCAGCTGCCCTGGATCCTCCTCTTCTCATAGCAAAACCC
AACAAAGTCCAGCTTATTGCCATGGATCTGCCCATGGTCAGTGGTGACCGGATCCACTGT
CTTGATATTTTATTTGCCTTTACAAAGCGTGTTTTGGGTGAGAGTGGAGAGATGGATGCC
CTTCGAATACAGATGGAAGACAGGTTTATGGCATCAAACCCCTCCAAAGTCTCTTATGAG
CCTATTACAACCACTTTGAAACGTAAACAAGAGGAGGTGTCTGCCGCTATCATTCAGCGT
AATTTCAGATGTTATCTTTTAAAGCAAAGGTTAAAAAATATATCAAGTAACTATAACAAA
GAGGCAATTAAAGGGAGGATTGACTTACCTATAAAACAAGACATGATTATTGACAAACTA
AATGGGAACTCCACTCCAGAAAAAACAGATGGGAGTTCCTCTACCACCTCTCCTCCTTCC
TATGATAGTGTAACAAAACCAGACAAGGAAAAGTTTGAGAAAGACAAACCAGAAAAAGAA
AGCAAAGGAAAAGAGGTCAGAGAAAATCAAAAGTAA
GenBank Gene IDAJ251507
GeneCard IDNot Available
GenAtlas IDSCN3A
HGNC IDHGNC:10590
Chromosome Location2
Locus2q24
References
  1. Rougier JS, van Bemmelen MX, Bruce MC, Jespersen T, Gavillet B, Apotheloz F, Cordonier S, Staub O, Rotin D, Abriel H: Molecular determinants of voltage-gated sodium channel regulation by the Nedd4/Nedd4-like proteins. Am J Physiol Cell Physiol. 2005 Mar;288(3):C692-701. Epub 2004 Nov 17. 15548568
  2. Kasai N, Fukushima K, Ueki Y, Prasad S, Nosakowski J, Sugata K, Sugata A, Nishizaki K, Meyer NC, Smith RJ: Genomic structures of SCN2A and SCN3A - candidate genes for deafness at the DFNA16 locus. Gene. 2001 Feb 7;264(1):113-22. 11245985
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Lu CM, Brown GB: Isolation of a human-brain sodium-channel gene encoding two isoforms of the subtype III alpha-subunit. J Mol Neurosci. 1998 Feb;10(1):67-70. 9589372
  5. Malo MS, Srivastava K, Andresen JM, Chen XN, Korenberg JR, Ingram VM: Targeted gene walking by low stringency polymerase chain reaction: assignment of a putative human brain sodium channel gene (SCN3A) to chromosome 2q24-31. Proc Natl Acad Sci U S A. 1994 Apr 12;91(8):2975-9. 8159690
  6. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. 10718198
  7. Weiss LA, Escayg A, Kearney JA, Trudeau M, MacDonald BT, Mori M, Reichert J, Buxbaum JD, Meisler MH: Sodium channels SCN1A, SCN2A and SCN3A in familial autism. Mol Psychiatry. 2003 Feb;8(2):186-94. 12610651