Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin alpha-8 chain
Synonyms
  • Alpha-tubulin 8
  • TUBAL2
  • Tubulin alpha chain-like 2
Gene NameTUBA8
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002699|Tubulin alpha-8 chain
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGK
HVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
Number of residues449
Molecular Weight50093.12
Theoretical pI4.7
GO Classification
Functions
  • structural constituent of cytoskeleton
  • GTP binding
  • GTPase activity
Processes
  • microtubule-based process
Components
  • microtubule
  • cytoplasm
  • microtubule cytoskeleton
General FunctionTubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Specific FunctionGtp binding
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID7594610
UniProtKB IDQ9NY65
UniProtKB Entry NameTBA8_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0051294|Tubulin alpha-8 chain (TUBA8)
ATGCGGGAATGCATATCAGTCCACGTGGGCCAAGCGGGAGTTCAGATTGGCAATGCCTGC
TGGGAGCTCTTCTGCCTGGAACACGGCATCCAGGCAGACGGCACTTTTGATGCTCAAGCT
AGCAAGATCAACGATGATGACTCCTTCACCACCTTTTTCAGCGAGACTGGCAATGGGAAG
CATGTGCCCCGGGCCGTCATGATAGATCTGGAGCCTACTGTAGTGGATGAGGTTCGGGCA
GGAACCTACCGCCAGCTCTTCCATCCAGAGCAGCTGATCACAGGAAAGGAGGATGCAGCC
AACAACTATGCCCGGGGCCACTACACGGTGGGCAAGGAGAGCATTGACCTGGTGCTGGAC
CGCATACGGAAGCTGACAGATGCTTGCTCTGGCCTGCAGGGCTTCCTGATTTTCCACAGT
TTTGGTGGGGGCACTGGCTCCGGCTTCACTTCTCTGCTGATGGAACGCCTCTCCCTGGAT
TATGGCAAGAAATCCAAGCTGGAGTTTGCCATCTACCCAGCCCCCCAGGTCTCTACTGCA
GTGGTGGAGCCCTACAACTCCATCCTGACCACCCACACCACACTGGAACATTCAGATTGT
GCTTTCATGGTGGACAACGAAGCCATCTATGACATCTGCCGCAGGAACCTTGACATTGAG
CGCCCTACCTATACCAACCTCAACCGCCTCATCAGTCAGATTGTGTCCTCAATCACTGCT
TCTCTCCGCTTTGACGGGGCCCTCAATGTGGACCTCACTGAGTTCCAGACCAACCTGGTG
CCCTACCCCCGCATCCACTTCCCGCTGGTCACCTACGCGCCCATCATCTCTGCCGAGAAA
GCCTATCACGAACAGCTCTCTGTGGCCGAGATAACCAGCTCCTGCTTTGAGCCCAACAGC
CAGATGGTGAAGTGCGACCCGAGACATGGCAAGTACATGGCCTGCTGCATGCTCTACCGG
GGCGACGTGGTGCCCAAGGATGTGAATGTCGCTATTGCTGCCATCAAGACCAAGAGGACC
ATCCAGTTTGTAGACTGGTGTCCCACAGGCTTCAAGGTGGGCATCAACTACCAGCCCCCG
ACCGTGGTCCCCGGGGGAGACCTGGCCAAGGTGCAGCGGGCCGTCTGCATGCTCAGCAAC
ACCACGGCCATTGCGGAGGCCTGGGCCCGCCTCGACCACAAGTTCGACCTCATGTACGCC
AAGCGGGCCTTTGTGCATTGGTATGTGGGAGAGGGGATGGAAGAAGGAGAATTTTCTGAG
GCCAGGGAAGACTTAGCTGCCCTGGAGAAGGATTATGAAGAAGTGGGGACTGATTCGTTT
GAAGAAGAAAATGAAGGGGAGGAATTTTAA
GenBank Gene IDAJ245922
GeneCard IDNot Available
GenAtlas IDTUBA8
HGNC IDHGNC:12410
Chromosome Location3
Locus3q27.2
References
  1. Stanchi F, Corso V, Scannapieco P, Ievolella C, Negrisolo E, Tiso N, Lanfranchi G, Valle G: TUBA8: A new tissue-specific isoform of alpha-tubulin that is highly conserved in human and mouse. Biochem Biophys Res Commun. 2000 Apr 21;270(3):1111-8. 10772959
  2. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Abdollahi MR, Morrison E, Sirey T, Molnar Z, Hayward BE, Carr IM, Springell K, Woods CG, Ahmed M, Hattingh L, Corry P, Pilz DT, Stoodley N, Crow Y, Taylor GR, Bonthron DT, Sheridan E: Mutation of the variant alpha-tubulin TUBA8 results in polymicrogyria with optic nerve hypoplasia. Am J Hum Genet. 2009 Nov;85(5):737-44. doi: 10.1016/j.ajhg.2009.10.007. Epub 2009 Nov 5. 19896110
  7. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. 19524510
  8. Braun A, Breuss M, Salzer MC, Flint J, Cowan NJ, Keays DA: Tuba8 is expressed at low levels in the developing mouse and human brain. Am J Hum Genet. 2010 May 14;86(5):819-22; author reply 822-3. doi: 10.1016/j.ajhg.2010.03.019. 20466094
  9. Valenstein ML, Roll-Mecak A: Graded Control of Microtubule Severing by Tubulin Glutamylation. Cell. 2016 Feb 25;164(5):911-21. doi: 10.1016/j.cell.2016.01.019. Epub 2016 Feb 11. 26875866