You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent T-type calcium channel subunit alpha-1I
Synonyms
  • Ca(v)3.3
  • KIAA1120
  • Voltage-gated calcium channel subunit alpha Cav3.3
Gene NameCACNA1I
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000024|Voltage-dependent T-type calcium channel subunit alpha-1I
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYHGKTKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQ
PIPATLASDPASCPCCQHEDGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDG
ASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIE
HHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGD
PKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRM
SYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEV
AADEGPPRAAPLHTPHAHHIHHGPHLAHRHRHHRRTLSLDNRDSVDLAELVPAVGAHPRA
AWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPD
WCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTE
RIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLN
VVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAELELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQEN
LWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNS
DRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPEN
FLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKGT
GTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSD
SPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLA
APGRPHAAALAHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASK
RKR
Number of residues2223
Molecular Weight245100.8
Theoretical pI6.52
GO Classification
Functions
  • voltage-gated calcium channel activity
  • low voltage-gated calcium channel activity
Processes
  • transport
  • signal transduction
  • axon guidance
  • sleep
  • membrane depolarization during action potential
  • neuronal action potential
  • calcium ion import
Components
  • voltage-gated calcium channel complex
  • plasma membrane
General FunctionVoltage-gated calcium channel activity
Specific FunctionVoltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H (By similarity).
Pfam Domain Function
Transmembrane Regions79-99 121-141 149-168 174-191 212-232 378-398 641-661 677-697 703-721 730-753 765-785 842-862 1167-1187 1210-1230 1245-1265 1273-1294 1305-1325 1411-1431 1486-1506 1523-1543 1557-1577 1584-1607 1622-1642 1710-1730
GenBank Protein ID5565888
UniProtKB IDQ9P0X4
UniProtKB Entry NameCAC1I_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0015995|Voltage-dependent T-type calcium channel subunit alpha-1I (CACNA1I)
ATGGCTGAGAGCGCCTCCCCGCCCTCCTCATCTGCAGCAGCCCCAGCCGCTGAGCCAGGA
GTCACCACGGAGCAGCCCGGACCCCGGAGCCCCCCATCCTCCCCGCCAGGCCTGGAGGAG
CCTCTGGATGGAGCTGATCCTCATGTCCCACACCCAGACCTGGCGCCTATTGCCTTCTTC
TGCCTGCGACAGACCACCAGCCCCCGGAACTGGTGCATCAAGATGGTGTGCAACCCGTGG
TTTGAATGTGTCAGCATGCTGGTGATCCTGCTGAACTGCGTGACACTTGGCATGTACCAG
CCGTGCGACGACATGGACTGCCTGTCCGACCGCTGCAAGATCCTGCAGGTCTTTGATGAC
TTCATCTTTATCTTCTTTGCCATGGAGATGGTGCTCAAGATGGTGGCCCTGGGGATTTTT
GGCAAGAAGTGCTACCTCGGGGACACATGGAACCGCCTGGATTTCTTCATCGTCATGGCA
GGGATGGTCGAGTACTCCCTGGACCTTCAGAACATCAACCTGTCAGCCATCCGCACCGTG
CGCGTCCTGAGGCCCCTCAAAGCCATCAACCGCGTGCCCAGTATGCGGATCCTGGTGAAC
CTGCTCCTGGACACACTGCCCATGCTGGGGAATGTCCTGCTGCTCTGCTTCTTTGTCTTC
TTCATCTTTGGCATCATAGGTGTGCAGCTCTGGGCGGGCCTGCTGCGTAACCGCTGCTTC
CTGGAGGAGAACTTCACCATACAAGGGGATGTGGCCTTGCCCCCATACTACCAGCCGGAG
GAGGATGATGAGATGCCCTTCATCTGCTCCCTGTCGGGCGACAATGGGATAATGGGCTGC
CATGAGATCCCCCCGCTCAAGGAGCAGGGCCGTGAGTGCTGCCTGTCCAAGGACGACGTC
TACGACTTTGGGGCGGGGCGCCAGGACCTCAATGCCAGCGGCCTCTGTGTCAACTGGAAC
CGTTACTACAATGTGTGCCGCACGGGCAGCGCCAACCCCCACAAGGGTGCCATCAACTTT
GACAACATCGGTTATGCTTGGATTGTCATCTTCCAGGTGATCACTCTGGAAGGCTGGGTG
GAGATCATGTACTACGTGATGGATGCTCACTCCTTCTACAACTTCATCTACTTCATCCTG
CTTATCATAGTGGGCTCCTTCTTCATGATCAACCTGTGCCTCGTTGTCATAGCGACCCAG
TTCTCGGAGACCAAGCAACGGGAGCACCGGCTGATGCTGGAGCAGCGGCAGCGCTACCTG
TCCTCCAGCACGGTGGCCAGCTACGCCGAGCCTGGCGACTGCTACGAGGAGATCTTCCAG
TATGTCTGCCACATCCTGCGCAAGGCCAAGCGCCGCGCCCTGGGCCTCTACCAGGCCCTG
CAGAGCCGGCGCCAGGCCCTGGGCCCGGAGGCCCCGGCCCCCGCCAAACCTGGGCCCCAC
GCCAAGGAGCCCCGGCACTACCAGCTGTGCCCGCAACATAGCCCCCTGGATGCGACGCCC
CACACCCTGGTGCAGCCCATCCCCGCCACGCTGGCTTCCGATCCCGCCAGCTGCCCTTGC
TGCCAGCATGAGGACGGCCGGCGGCCCTCGGGCCTGGGCAGCACCGACTCGGGCCAGGAG
GGCTCGGGCTCCGGGAGCTCCGCTGGTGGCGAGGACGAGGCGGATGGGGACGGGGCCCGG
AGCAGCGAGGACGGAGCCTCCTCAGAACTGGGGAAGGAGGAGGAGGAGGAGGAGCAGGCG
GATGGGGCGGTCTGGCTGTGCGGGGATGTGTGGCGGGAGACGCGAGCCAAGCTGCGCGGC
ATCGTGGACAGCAAGTACTTCAACCGGGGCATCATGATGGCCATCCTGGTCAACACCGTC
AGCATGGGCATCGAGCACCACGAGCAGCCGGAGGAGCTGACCAACATCCTGGAGATCTGC
AATGTGGTCTTCACCAGCATGTTTGCCCTGGAGATGATCCTGAAGCTGGCTGCATTTGGG
CTCTTCGACTACCTGCGTAACCCCTACAACATCTTCGACAGCATCATTGTCATCATCAGC
ATCTGGGAGATTGTGGGGCAGGCGGACGGTGGGCTGTCGGTGCTGCGGACCTTCCGGCTG
CTGCGCGTGCTGAAACTGGTGCGCTTCATGCCTGCCCTGCGGCGCCAGCTCGTGGTGCTC
ATGAAGACCATGGACAACGTGGCCACCTTCTGCATGCTGCTCATGCTCTTCATCTTCATC
TTCAGCATCCTTGGGATGCATATTTTTGGCTGCAAGTTCAGCCTCCGCACGGACACTGGA
GACACGGTGCCCGACAGGAAGAACTTCGACTCCCTGCTGTGGGCCATCGTCACTGTGTTC
CAGATCCTCACCCAGGAGGACTGGAACGTCGTTCTCTACAATGGCATGGCCTCCACTTCT
CCCTGGGCCTCCCTCTACTTTGTCGCCCTCATGACCTTCGGCAACTATGTGCTCTTCAAC
CTGCTGGTGGCCATCCTGGTGGAGGGCTTCCAGGCGGAGGGTGACGCCAATCGCTCCTAC
TCGGACGAGGACCAGAGCTCATCCAACATAGAAGAGTTTGATAAGCTCCAGGAAGGCCTG
GACAGCAGCGGAGATCCCAAGCTCTGCCCAATCCCCATGACCCCCAATGGGCACCTGGAC
CCCAGTCTCCCACTGGGTGGGCACCTAGGTCCTGCTGGGGCTGCGGGACCTGCCCCCCGA
CTCTCACTGCAGCCGGACCCCATGCTGGTGGCCCTGGGCTCCCGAAAGAGCAGTGTCATG
TCTCTAGGGAGGATGAGCTATGACCAGCGCTCCCTGTCCAGCTCCCGGAGCTCCTACTAC
GGGCCATGGGGCCGCAGCGCGGCCTGGGCCAGCCGTCGCTCCAGCTGGAACAGCCTCAAG
CACAAGCCGCCGTCGGCGGAGCATGAGTCCCTGCTCTCTGCGGAGCGCGGCGGCGGCGCC
CGGGTCTGCGAGGTTGCCGCGGACGAGGGGCCGCCGCGGGCCGCACCCCTGCACACCCCA
CACGCCCACCACATTCATCACGGGCCCCATCTGGCGCACCGCCACCGCCACCACCGCCGG
ACGCTGTCCCTCGACAACAGGGACTCGGTGGACCTGGCCGAGCTGGTGCCCGCGGTGGGC
GCCCACCCCCGGGCCGCCTGGAGGGCGGCAGGCCCGGCCCCCGGGCATGAGGACTGCAAT
GGCAGGATGCCCAGCATCGCCAAAGACGTCTTCACCAAGATGGGCGACCGCGGGGATCGC
GGGGAGGATGAGGAGGAAATCGACTACACCCTGTGCTTCCGCGTCCGCAAGATGATCGAC
GTCTATAAGCCCGACTGGTGCGAGGTCCGCGAAGACTGGTCTGTCTACCTCTTCTCTCCC
GAGAACAGGTTCCGGGTCCTGTGTCAGACCATTATTGCCCACAAACTCTTCGACTACGTC
GTCCTGGCCTTCATCTTTCTCAACTGCATCACCATCGCCCTGGAGCGGCCTCAGATCGAG
GCCGGCAGCACCGAACGCATCTTTCTCACCGTGTCCAACTACATCTTCACGGCCATCTTC
GTGGGCGAGATGACATTGAAGGTAGTCTCGCTGGGCCTGTACTTCGGCGAGCAGGCGTAC
CTACGCAGCAGCTGGAACGTGCTGGATGGCTTTCTTGTCTTCGTGTCCATCATCGACATC
GTGGTGTCCCTGGCCTCAGCCGGGGGAGCCAAGATCTTGGGGGTCCTCCGAGTCTTGCGG
CTCCTGCGCACCCTACGCCCCCTGCGTGTCATCAGCCGGGCGCCGGGCCTGAAGCTGGTG
GTGGAGACACTCATCTCCTCCCTCAAGCCCATCGGCAACATCGTGCTCATCTGCTGTGCC
TTCTTCATCATCTTTGGCATCCTGGGAGTGCAGCTCTTCAAGGGCAAGTTCTACCACTGT
CTGGGCGTGGACACCCGCAACATCACCAACCGCTCGGACTGCATGGCCGCCAACTACCGC
TGGGTCCATCACAAATACAACTTCGACAACCTGGGCCAGGCTCTGATGTCCCTCTTTGTC
CTGGCATCCAAGGATGGTTGGGTGAACATCATGTACAATGGACTGGATGCTGTTGCTGTG
GACCAGCAGCCTGTGACCAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTG
CTCATCGTCAGCTTCTTTGTGCTCAACATGTTTGTGGGTGTCGTGGTGGAGAACTTCCAC
AAGTGCCGGCAGCACCAGGAGGCTGAAGAGGCACGGCGGCGTGAGGAGAAGCGGCTGCGG
CGCCTGGAGAAGAAGCGCCGGAAGGCCCAGCGGCTGCCCTACTATGCCACCTATTGTCAC
ACCCGGCTGCTCATCCACTCCATGTGCACCAGCCACTACCTGGACATCTTCATCACCTTC
ATCATCTGCCTCAACGTGGTCACCATGTCCCTGGAGCACTACAATCAGCCCACGTCCCTG
GAGACAGCCCTCAAGTACTGCAACTATATGTTCACCACTGTCTTTGTGCTGGAGGCTGTG
CTGAAGCTGGTGGCATTTGGTCTGAGGCGCTTCTTCAAGGACCGATGGAACCAGCTGGAC
CTGGCCATTGTGCTACTGTCAGTCATGGGCATCACCCTGGAGGAGATCGAGATCAATGCG
GCCCTGCCCATCAATCCCACCATCATCCGCATCATGAGGGTTCTGCGCATTGCCCGAGTG
CTGAAGCTGTTGAAGATGGCCACAGGAATGCGGGCCCTGCTGGACACGGTGGTGCAAGCT
TTGCCCCAGGTGGGCAACCTGGGCCTCCTCTTCATGCTGCTCTTCTTCATCTATGCTGCT
CTCGGGGTGGAGCTCTTTGGGAAGCTGGTCTGCAACGACGAGAACCCGTGCGAGGGCATG
AGCCGGCATGCCACCTTCGAGAACTTCGGCATGGCCTTCCTCACACTCTTCCAGGTCTCC
ACGGGTGACAACTGGAACGGGATCATGAAGGACACGCTGCGGGACTGCACCCACGACGAG
CGCAGCTGCCTGAGCAGCCTGCAGTTTGTGTCGCCGCTGTACTTCGTGAGCTTCGTGCTC
ACCGCGCAGTTCGTGCTCATCAACGTGGTGGTGGCTGTGCTCATGAAGCACCTGGACGAC
AGCAACAAGGAGGCGCAGGAGGACGCCGAGATGGATGCCGAGCTCGAGCTGGAGATGGCC
CATGGCCTGGGCCCTGGCCCGAGGCTGCCTACCGGCTCCCCGGGCGCCCCTGGCCGAGGG
CCGGGAGGGGCGGGCGGCGGGGGCGACACCGAGGGCGGCTTGTGCCGGCGCTGCTACTCG
CCTGCCCAGGAGAACCTGTGGCTGGACAGCGTCTCTTTAATCATCAAGGACTCCTTGGAG
GGGGAGCTGACCATCATCGACAACCTGTCGGGCTCCATCTTCCACCACTACTCCTCGCCT
GCCGGCTGCAAGAAGTGTCACCACGACAAGCAAGAGGTGCAGCTGGCTGAGACGGAGGCC
TTCTCCCTGAACTCAGACAGGTCCTCGTCCATCCTGCTGGGTGACGACCTGAGTCTCGAG
GACCCCACAGCCTGCCCACCTGGCCGCAAAGACAGCAAGGGTGAGCTGGACCCACCTGAG
CCCATGCGTGTGGGAGACCTGGGCGAATGCTTCTTCCCCTTGTCCTCTACGGCCGTCTCG
CCGGATCCAGAGAACTTCCTGTGTGAGATGGAGGAGATCCCATTCAACCCTGTCCGGTCC
TGGCTGAAACATGACAGCAGTCAAGCACCCCCAAGTCCCTTCTCCCCGGATGCCTCCAGC
CCTCTCCTGCCCATGCCAGCCGAGTTCTTCCACCCTGCAGTGTCTGCCAGCCAGAAAGGC
CCAGAAAAGGGCACTGGCACTGGAACCCTCCCCAAGATTGCGCTGCAGGGCTCCTGGGCA
TCTCTGCGGTCACCAAGGGTCAACTGTACCCTCCTCCGGCAGGCCACCGGGAGCGACACG
TCGCTGGACGCCAGCCCCAGCAGCTCCGCGGGCAGCCTGCAGACCACGCTCGAGGACAGC
CTGACCCTGAGCGACAGCCCCCGGCGTGCCCTGGGGCCGCCCGCGCCTGCTCCAGGACCC
CGGGCCGGCCTGTCCCCCGCCGCTCGCCGCCGCCTGAGCCTGCGCGGCCGGGGCCTCTTC
AGCCTGCGGGGGCTGCGGGCGCATCAGCGCAGCCACAGCAGCGGGGGCTCCACCAGCCCG
GGCTGCACCCACCACGACTCCATGGACCCCTCGGACGAGGAGGGCCGCGGTGGCGCGGGC
GGCGGGGGCGCGGGCAGCGAGCACTCGGAGACCCTCAGCAGCCTCTCGCTCACCTCCCTC
TTCTGCCCGCCGCCCCCGCCGCCAGCCCCCGGCCTCACGCCCGCCAGGAAGTTCAGCAGC
ACCAGCAGCCTGGCCGCCCCCGGCCGCCCCCACGCCGCCGCCCTGGCCCACGGCCTGGCC
CGGAGCCCCTCGTGGGCCGCGGACCGCAGCAAGGACCCCCCCGGCCGGGCACCGCTGCCC
ATGGGCCTGGGCCCCTTGGCGCCCCCGCCGCAACCGCTCCCCGGAGAGCTGGAGCCGGGA
GACGCCGCCAGCAAGAGGAAGAGATGA
GenBank Gene IDAF129133
GeneCard IDNot Available
GenAtlas IDCACNA1I
HGNC IDHGNC:1396
Chromosome Location22
Locus22q13.1
References
  1. Mittman S, Guo J, Emerick MC, Agnew WS: Structure and alternative splicing of the gene encoding alpha1I, a human brain T calcium channel alpha1 subunit. Neurosci Lett. 1999 Jul 16;269(3):121-4. 10454147
  2. Monteil A, Chemin J, Leuranguer V, Altier C, Mennessier G, Bourinet E, Lory P, Nargeot J: Specific properties of T-type calcium channels generated by the human alpha 1I subunit. J Biol Chem. 2000 Jun 2;275(22):16530-5. 10749850
  3. Gomora JC, Murbartian J, Arias JM, Lee JH, Perez-Reyes E: Cloning and expression of the human T-type channel Ca(v)3.3: insights into prepulse facilitation. Biophys J. 2002 Jul;83(1):229-41. 12080115
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. 10574461
  6. Zhang D, Chen J, Saraf A, Cassar S, Han P, Rogers JC, Brioni JD, Sullivan JP, Gopalakrishnan M: Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity. J Biol Chem. 2006 Aug 4;281(31):22332-41. Epub 2006 Jun 1. 16740636
  7. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332