Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
Synonyms
  • KIAA1535
Gene NameHCN3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008816|Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
Number of residues774
Molecular Weight86030.975
Theoretical pINot Available
GO Classification
Functions
  • voltage-gated potassium channel activity
  • voltage-gated sodium channel activity
  • cAMP binding
Processes
  • synaptic transmission
  • response to cisplatin
  • cellular response to dopamine
  • sodium ion transmembrane transport
  • potassium ion transmembrane transport
  • regulation of membrane potential
Components
  • integral component of plasma membrane
  • dendrite
  • synapse
  • neuronal cell body
  • plasma membrane
  • cone cell pedicle
General FunctionVoltage-gated sodium channel activity
Specific FunctionHyperpolarization-activated potassium channel. May also facilitate the permeation of sodium ions.
Pfam Domain Function
Transmembrane Regions98-118 125-145 172-192 202-222 254-274 330-350
GenBank Protein IDNot Available
UniProtKB IDQ9P1Z3
UniProtKB Entry NameHCN3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013432|Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 (HCN3)
ATGGAGGCAGAGCAGCGGCCGGCGGCGGGGGCCAGCGAAGGGGCGACCCCTGGACTGGAG
GCGGTGCCTCCCGTTGCTCCCCCGCCTGCGACCGCGGCCTCAGGTCCGATCCCCAAATCT
GGGCCTGAGCCTAAGAGGAGGCACCTTGGGACGCTGCTCCAGCCTACGGTCAACAAGTTC
TCCCTTCGGGTGTTCGGCAGCCACAAAGCAGTGGAAATCGAGCAGGAGCGGGTGAAGTCA
GCGGGGGCCTGGATCATCCACCCCTACAGCGACTTCCGGTTTTACTGGGACCTGATCATG
CTGCTGCTGATGGTGGGGAACCTCATCGTCCTGCCTGTGGGCATCACCTTCTTCAAGGAG
GAGAACTCCCCGCCTTGGATCGTCTTCAACGTATTGTCTGATACTTTCTTCCTACTGGAT
CTGGTGCTCAACTTCCGAACGGGCATCGTGGTGGAGGAGGGTGCTGAGATCCTGCTGGCA
CCGCGGGCCATCCGCACGCGCTACCTGCGCACCTGGTTCCTGGTTGACCTCATCTCTTCT
ATCCCTGTGGATTACATCTTCCTAGTGGTGGAGCTGGAGCCACGGTTGGACGCTGAGGTC
TACAAAACGGCACGGGCCCTACGCATCGTTCGCTTCACCAAGATCCTAAGCCTGCTGAGG
CTGCTCCGCCTCTCCCGCCTCATCCGCTACATACACCAGTGGGAGGAGATCTTTCACATG
ACCTATGACCTGGCCAGTGCTGTGGTTCGCATCTTCAACCTCATTGGGATGATGCTGCTG
CTATGTCACTGGGATGGCTGTCTGCAGTTCCTGGTGCCCATGCTGCAGGACTTCCCTCCC
GACTGCTGGGTCTCCATCAACCACATGGTGAACCACTCGTGGGGCCGCCAGTATTCCCAT
GCCCTGTTCAAGGCCATGAGCCACATGCTGTGCATTGGCTATGGGCAGCAGGCACCTGTA
GGCATGCCCGACGTCTGGCTCACCATGCTCAGCATGATCGTAGGTGCCACATGCTACGCC
ATGTTCATCGGCCATGCCACGGCACTCATCCAGTCCCTGGACTCTTCCCGGCGTCAGTAC
CAGGAGAAGTACAAGCAGGTGGAGCAGTACATGTCCTTCCACAAGCTGCCAGCAGACACG
CGGCAGCGCATCCACGAGTACTATGAGCACCGCTACCAGGGCAAGATGTTCGATGAGGAA
AGCATCCTGGGCGAGCTGAGCGAGCCGCTTCGCGAGGAGATCATTAACTTCACCTGTCGG
GGCCTGGTGGCCCACATGCCGCTGTTTGCCCATGCCGACCCCAGCTTCGTCACTGCAGTT
CTCACCAAGCTGCGCTTTGAGGTCTTCCAGCCGGGGGATCTCGTGGTGCGTGAGGGCTCC
GTGGGGAGGAAGATGTACTTCATCCAGCATGGGCTGCTCAGTGTGCTGGCCCGCGGCGCC
CGGGACACACGCCTCACCGATGGATCCTACTTTGGGGAGATCTGCCTGCTAACTAGGGGC
CGGCGCACAGCCAGTGTTCGGGCTGACACCTACTGCCGCCTTTACTCACTCAGCGTGGAC
CATTTCAATGCTGTGCTTGAGGAGTTCCCCATGATGCGCCGGGCCTTTGAGACTGTGGCC
ATGGATCGGCTGCTCCGCATCGGCAAGAAGAATTCCATACTGCAGCGGAAGCGCTCCGAG
CCAAGTCCAGGCAGCAGTGGTGGCATCATGGAGCAGCACTTGGTGCAACATGACAGAGAC
ATGGCTCGGGGTGTTCGGGGTCGGGCCCCGAGCACAGGAGCTCAGCTTAGTGGAAAGCCA
GTACTGTGGGAGCCACTGGTACATGCGCCCCTTCAGGCAGCTGCTGTGACCTCCAATGTG
GCCATTGCCCTGACTCATCAGCGGGGCCCTCTGCCCCTCTCCCCTGACTCTCCAGCCACC
CTCCTTGCTCGCTCTGCTTGGCGCTCAGCAGGCTCTCCAGCTTCCCCGCTGGTGCCCGTC
CGAGCTGGCCCATGGGCATCCACCTCCCGCCTGCCCGCCCCACCTGCCCGAACCCTGCAC
GCCAGCCTATCCCGGGCAGGGCGCTCCCAGGTCTCCCTGCTGGGTCCCCCTCCAGGAGGA
GGTGGACGGCGGCTAGGACCTCGGGGCCGCCCACTCTCAGCCTCCCAACCCTCTCTGCCT
CAGCGGGCAACAGGCGATGGCTCTCCTGGGCGTAAGGGATCAGGAAGTGAGCGGCTGCCT
CCCTCAGGGCTCCTGGCCAAACCTCCAAGGACAGCCCAGCCCCCCAGGCCACCAGTGCCT
GAGCCAGCCACACCCCGGGGTCTCCAGCTTTCTGCCAACATGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:19183
Chromosome Location1
LocusNot Available
References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  2. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. 10819331
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Stieber J, Stockl G, Herrmann S, Hassfurth B, Hofmann F: Functional expression of the human HCN3 channel. J Biol Chem. 2005 Oct 14;280(41):34635-43. Epub 2005 Jul 25. 16043489