You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit alpha-9
Synonyms
  • NACHR alpha-9
  • NACHRA9
  • Nicotinic acetylcholine receptor subunit alpha-9
Gene NameCHRNA9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011683|Neuronal acetylcholine receptor subunit alpha-9
MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTL
QITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLS
PHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD
Number of residues479
Molecular Weight54806.63
Theoretical pI6.42
GO Classification
Functions
  • acetylcholine-activated cation-selective channel activity
  • calcium channel activity
  • acetylcholine-gated cation channel activity
Processes
  • neurological system process
  • signal transduction
  • detection of mechanical stimulus involved in sensory perception of sound
  • inner ear morphogenesis
  • synaptic transmission
  • positive regulation of cytosolic calcium ion concentration
  • synaptic transmission, cholinergic
  • neuromuscular synaptic transmission
  • response to nicotine
  • regulation of membrane potential
  • cation transmembrane transport
Components
  • acetylcholine-gated channel complex
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • cytosol
  • integral component of plasma membrane
  • synapse
  • neuron projection
General FunctionCalcium channel activity
Specific FunctionIonotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding induces a conformation change that leads to the opening of an ion-conducting channel across the plasma membrane (PubMed:11752216, PubMed:25282151). The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane (PubMed:11752216, PubMed:25282151). In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma. May also regulate keratinocyte adhesion (PubMed:11021840).
Pfam Domain Function
Transmembrane Regions238-262 269-287 302-323 458-476
GenBank Protein ID6688136
UniProtKB IDQ9UGM1
UniProtKB Entry NameACHA9_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0011684|Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9)
ATGAACTGGTCCCATTCCTGCATCTCCTTTTGCTGGATCTACTTTGCTGCTTCCAGACTG
AGAGCTGCAGAGACGGCAGATGGAAAATATGCTCAGAAGTTGTTTAATGACCTTTTTGAA
GATTATTCTAATGCTCTTCGTCCAGTGGAAGATACAGATAAAGTCCTGAATGTGACCCTG
CAGATTACGCTCTCTCAGATTAAGGATATGGATGAAAGAAACCAAATTCTGACTGCTTAT
TTGTGGATCCGCCAAATCTGGCACGATGCCTATCTCACGTGGGACCGAGATCAGTACGAT
GGCCTAGACTCCATCAGGATCCCCAGTGACCTCGTGTGGAGGCCAGACATCGTCTTATAT
AACAAGGCTGATGATGAATCTTCAGAGCCTGTGAACACCAATGTGGTCCTGCGGTATGAT
GGGCTGATCACCTGGGATGCACCGGCCATCACCAAAAGCTCCTGTGTGGTGGATGTCACC
TACTTCCCTTTTGACAACCAGCAGTGCAACCTGACTTTTGGTTCCTGGACCTACAATGGC
AATCAGGTGGACATATTCAACGCCTTGGACAGCGGAGATCTCTCTGACTTCATTGAAGAT
GTGGAATGGGAGGTCCATGGCATGCCCGCTGTGAAGAATGTGATCTCCTATGGCTGCTGC
TCTGAGCCTTACCCGGATGTCACATTCACCCTCCTTCTGAAGAGGAGGTCCTCGTTCTAT
ATCGTCAACCTCCTCATCCCATGCGTCCTCATATCTTTTCTGGCTCCTCTGAGTTTTTAT
CTCCCAGCAGCCTCCGGAGAAAAGGTCTCCCTGGGAGTGACCATCCTGTTGGCCATGACT
GTATTTCAGCTAATGGTGGCAGAAATCATGCCGGCCTCAGAAAATGTGCCCCTGATAGGT
AAATACTACATAGCCACGATGGCCCTGATCACAGCCTCCACTGCGTTGACCATCATGGTG
ATGAATATCCACTTCTGTGGGGCCGAGGCCCGGCCGGTGCCACACTGGGCCAGGGTGGTC
ATCCTGAAATACATGTCCAGGGTCTTGTTTGTCTATGATGTGGGTGAAAGCTGCCTCAGC
CCGCACCACAGTAGAGAGCGGGACCACCTCACGAAAGTTTATAGCAAACTCCCAGAGTCT
AACCTGAAAGCAGCCAGGAACAAAGACCTTTCCAGAAAGAAGGACATGAACAAACGCTTA
AAGAACGACCTGGGCTGCCAGGGTAAGAACCCTCAGGAGGCCGAGAGTTACTGTGCACAG
TACAAAGTGCTGACGAGGAATATTGAGTACATCGCCAAGTGCCTCAAAGACCACAAGGCC
ACCAATTCCAAGGGGAGTGAATGGAAGAAGGTGGCGAAAGTCATAGACCGATTCTTCATG
TGGATTTTTTTCATTATGGTGTTTGTGATGACTATTTTGATCATAGCAAGAGCGGATTAG
GenBank Gene IDAJ243342
GeneCard IDNot Available
GenAtlas IDCHRNA9
HGNC IDHGNC:14079
Chromosome Location4
Locus4p14
References
  1. Sgard F, Charpantier E, Bertrand S, Walker N, Caput D, Graham D, Bertrand D, Besnard F: A novel human nicotinic receptor subunit, alpha10, that confers functionality to the alpha9-subunit. Mol Pharmacol. 2002 Jan;61(1):150-9. 11752216
  2. Lustig LR, Peng H: Chromosome location and characterization of the human nicotinic acetylcholine receptor subunit alpha (alpha) 9 (CHRNA9) gene. Cytogenet Genome Res. 2002;98(2-3):154-9. 12697997
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Nguyen VT, Ndoye A, Grando SA: Novel human alpha9 acetylcholine receptor regulating keratinocyte adhesion is targeted by Pemphigus vulgaris autoimmunity. Am J Pathol. 2000 Oct;157(4):1377-91. 11021840
  6. Peng H, Ferris RL, Matthews T, Hiel H, Lopez-Albaitero A, Lustig LR: Characterization of the human nicotinic acetylcholine receptor subunit alpha (alpha) 9 (CHRNA9) and alpha (alpha) 10 (CHRNA10) in lymphocytes. Life Sci. 2004 Dec 3;76(3):263-80. 15531379
  7. Zouridakis M, Giastas P, Zarkadas E, Chroni-Tzartou D, Bregestovski P, Tzartos SJ: Crystal structures of free and antagonist-bound states of human alpha9 nicotinic receptor extracellular domain. Nat Struct Mol Biol. 2014 Nov;21(11):976-80. doi: 10.1038/nsmb.2900. Epub 2014 Oct 5. 25282151