You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin epsilon chain
Synonyms
  • Epsilon-tubulin
  • TUBE
Gene NameTUBE1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017196|Tubulin epsilon chain
MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSIS
KGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLY
QDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPS
GEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLV
TSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLV
SSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLR
RNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLY
KKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM
Number of residues475
Molecular Weight52931.4
Theoretical pI6.62
GO Classification
Functions
  • structural constituent of cytoskeleton
  • GTP binding
  • GTPase activity
Processes
  • centrosome cycle
Components
  • pericentriolar material
  • microtubule
General FunctionStructural constituent of cytoskeleton
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID6457582
UniProtKB IDQ9UJT0
UniProtKB Entry NameTBE_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0017197|Tubulin epsilon chain (TUBE1)
ATGACCCAGTCGGTGGTCGTACAGGTCGGCCAGTGCGGAAACCAGATCGGCTGCTGCTTC
TGGGACCTGGCACTAAGGGAGCACGCCGCGGTCAACCAGAAAGGAATTTATGATGAGGCA
ATAAGCAGCTTCTTTAGAAATGTGGACACCAGAGTGGTTGGTGATGGTGGAAGTATTTCC
AAGGGAAAAATATGTTCTTTAAAAGCACGAGCAGTCTTGATTGATATGGAAGAAGGGGTA
GTGAATGAAATTCTGCAGGGACCACTGAGAGATGTATTTGATACGAAACAGCTCATCACT
GATATTTCTGGCTCAGGAAATAATTGGGCCGTGGGTCACAAAGTTTTCGGCAGTCTTTAC
CAAGACCAGATTTTAGAGAAATTCAGAAAGTCGGCAGAGCACTGTGATTGCTTGCAGTGT
TTCTTTATAATACATTCCATGGGAGGAGGAACAGGATCTGGACTTGGCACATTTCTTTTA
AAGGTGCTTGAAGACGAATTCCCAGAAGTATACAGATTTGTGACTTCCATTTATCCTTCT
GGTGAGGATGATGTCATAACCTCACCTTATAATAGCATCTTGGCAATGAAGGAACTTAAT
GAGCATGCAGACTGTGTATTGCCCATTGACAATCAATCTTTATTTGACATCATTAGCAAA
ATCGACCTCATGGTGAATTCTGGAAAGTTGGGTACAACTGTGAAGCCAAAGAGTCTGGTT
ACTTCAAGTTCTGGGGCTTTAAAAAAGCAGCATAAGAAGCCCTTTGATGCAATGAATAAC
ATTGTGGCAAATTTGCTCCTCAACCTAACGAGCTCTGCAAGATTTGAAGGGTCCCTTAAT
ATGGACCTTAATGAAATCAGCATGAATTTAGTTCCTTTTCCTCAACTTCATTATCTCGTG
TCAAGCCTAACACCTCTGTATACACTGACAGATGTTAACATTCCTCCTAGAAGATTGGAT
CAGATGTTTTCAGATGCCTTTAGTAAAGATCACCAGCTGCTTCGGGCAGACCCCAAACAC
AGTCTTTACCTCGCCTGTGCACTCATGGTTAGAGGAAATGTACAAATTTCAGATCTTCGT
AGAAATATTGAAAGATTAAAACCATCTCTACAATTTGTCTCCTGGAATCAAGAAGGCTGG
AAGACCAGCCTGTGTTCCGTACCTCCTGTGGGCCATTCTCATTCGTTATTAGCTTTAGCA
AATAACACATGTGTGAAGCCCACCTTCATGGAACTGAAAGAGAGATTCATGAGGCTCTAC
AAGAAAAAGGCTCACCTTCATCACTATCTACAAGTTGAAGGGATGGAAGAAAGCTGTTTC
ACAGAAGCTGTGTCATCTTTATCAGCACTCATACAGGAATATGACCAACTGGACGCCACA
AAAAACATGCCTGTGCAGGATTTACCCAGACTAAGCATAGCTATGTGA
GenBank Gene IDAF201334
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:20775
Chromosome Location6
Locus6q21
References
  1. Chang P, Stearns T: Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function. Nat Cell Biol. 2000 Jan;2(1):30-5. 10620804
  2. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334