You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin delta chain
Synonyms
  • Delta-tubulin
  • TUBD
Gene NameTUBD1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0007128|Tubulin delta chain
MSIVTVQLGQCGNQIGFEVFDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPI
ARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIM
NIIRKEVEKCDSFSGFFIIMSMAGGTGSGLGAFVTQNLEDQYSNSLKMNQIIWPYGTGEV
IVQNYNSILTLSHLYRSSDALLLHENDAIHKICAKLMNIKQISFSDINQVLAHQLGSVFQ
PTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLR
QMLISNAKMEEGIDRHVWPPLSGLPPLSKMSLNKDLHFNTSIANLVILRGKDVQSADVEG
FKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK
AYIHQYTKFGIEEEDFLDSFTSLEQVVASYCNL
Number of residues453
Molecular Weight51033.86
Theoretical pI6.83
GO Classification
Functions
  • structural constituent of cytoskeleton
  • GTP binding
  • GTPase activity
Processes
  • cell differentiation
  • multicellular organismal development
  • spermatogenesis
  • microtubule-based process
Components
  • microtubule
  • nucleoplasm
  • centriole
  • cytoplasm
General FunctionStructural constituent of cytoskeleton
Specific FunctionIn the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID6457580
UniProtKB IDQ9UJT1
UniProtKB Entry NameTBD_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0012586|Tubulin delta chain (TUBD1)
ATGTCAATTGTAACAGTGCAACTTGGTCAGTGTGGCAATCAGATTGGTTTTGAAGTTTTT
GATGCTTTGCTTAGTGACTCACACAGTTCCCAGGGACTCTGCTCTATGAGAGAGAATGAG
GCATATCAAGCATCTTGCAAAGAAAGATTCTTCAGTGAGGAGGAGAATGGAGTTCCAATT
GCCCGGGCTGTTCTTGTTGACATGGAACCCAAAGTTATCAATCAAATGCTGTCAAAGGCT
GCCCAGTCTGGCCAATGGAAATATGGTCAACATGCATGCTTCTGTCAAAAACAAGGTTCT
GGAAACAACTGGGCATATGGTTACTCTGTTCATGGACCCAGGCATGAAGAATCTATAATG
AACATAATCCGGAAGGAAGTGGAGAAATGTGACTCTTTCAGTGGTTTTTTCATCATAATG
AGTATGGCTGGGGGCACAGGATCAGGATTAGGAGCTTTCGTTACACAGAATTTAGAAGAT
CAGTACTCAAACTCATTGAAAATGAATCAGATTATTTGGCCTTATGGAACTGGTGAGGTT
ATTGTTCAAAACTACAACTCCATTTTGACACTTTCTCACTTGTACCGATCTTCAGACGCC
CTCCTTCTTCATGAGAATGATGCCATCCATAAGATCTGTGCAAAACTGATGAATATCAAG
CAGATCTCCTTTAGTGATATCAATCAAGTCCTCGCACATCAGCTGGGAAGTGTGTTCCAG
CCTACTTATTCTGCAGAAAGCTCATTTCACTACAGACGAAATCCACTAGGTATTGATAGG
CATGTATGGCCTCCTTTATCAGGACTTCCTCCTCTTAGTAAAATGTCTCTCAACAAGGAC
CTGCATTTTAACACTTCCATTGCTAACTTGGTCATTCTTCGTGGGAAAGATGTGCAAAGT
GCAGATGTGGAGGGATTTAAAGATCCAGCTCTGTATACTTCCTGGTTGAAGCCTGTTAAT
GCTTTCAACGTGTGGAAAACCCAGCGGGCCTTTAGCAAATATGAGAAGTCTGCAGTGTTG
GTCAGCAACAGCCAGTTCTTAGTAAAACCACTTGATATGATTGTTGGGAAGGCATGGAAT
ATGTTTGCTTCAAAAGCCTACATTCATCAGTACACAAAATTTGGAATCGAAGAAGAGGAC
TTTTTAGACAGTTTCACGTCATTAGAGCAGGTTGTTGCCAGTTACTGTAATCTCTGA
GenBank Gene IDAF201333
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:16811
Chromosome Location17
Locus17q23.1
References
  1. Chang P, Stearns T: Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function. Nat Cell Biol. 2000 Jan;2(1):30-5. 10620804
  2. Kato A, Nagata Y, Todokoro K: Delta-tubulin is a component of intercellular bridges and both the early and mature perinuclear rings during spermatogenesis. Dev Biol. 2004 May 1;269(1):196-205. 15081367
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334